KEGG   Lonsdalea britannica: CKQ53_09235Help
Entry
CKQ53_09235       CDS       T05623                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lbq  Lonsdalea britannica
Pathway
lbq00061  Fatty acid biosynthesis
lbq00780  Biotin metabolism
lbq01100  Metabolic pathways
lbq01212  Fatty acid metabolism
Module
lbq_M00083  Fatty acid biosynthesis, elongation
lbq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CKQ53_09235 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CKQ53_09235 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lbq01004]
    CKQ53_09235 (fabZ)
Enzymes [BR:lbq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CKQ53_09235 (fabZ)
Lipid biosynthesis proteins [BR:lbq01004]
 Fatty acid synthase
  Component type
   CKQ53_09235 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT PS-DH MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AXW87145
UniProt: A0A1X3RPZ3
LinkDB All DBs
Position
2024559..2025014
Genome map
AA seq 151 aa AA seqDB search
MNTDTHTLHIEEILELLPHRYPFLLVDRVLHFEEGKFLRAVKNISFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDNARFKRPVEPGDQMVLEVEFIKE
RRGVARFRGVAKVDGEIACEAEMMCARRREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgaatactgacacccatactctgcacattgaagagattctggaactgttgccgcaccgc
tatccgtttttgctggtagaccgcgtactgcatttcgaagaaggtaaatttttacgtgca
gtgaaaaacatttcctttaatgaaccctttttccagggacattttccaggtaaaccgatt
ttccctggcgtgctgattctggaagccatggcacaggctaccggcattctggcattcaaa
agcgtgggtaaactggaaccgggcgaactgtactactttgctgcaatcgacaatgcgcgc
tttaaacgtcctgttgagccgggcgaccagatggtactggaagtggaattcatcaaagaa
cgtcgtggcgtcgctcgtttcagaggcgttgcgaaagtcgatggtgaaatcgcttgtgaa
gcagagatgatgtgcgctcgtcgtcgggaggcatga

DBGET integrated database retrieval system