KEGG   Lactobacillus brevis ATCC 367: LVIS_0345Help
Entry
LVIS_0345         CDS       T00406                                 

Definition
(GenBank) Predicted permease
  KO
K07090  uncharacterized protein
Organism
lbr  Lactobacillus brevis ATCC 367
Brite
KEGG Orthology (KO) [BR:lbr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    LVIS_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF3138
Motif
Other DBs
NCBI-ProteinID: ABJ63511
UniProt: Q03TG1
LinkDB All DBs
Position
368769..369614
Genome map
AA seq 281 aa AA seqDB search
MIQTAILMLAVGIFAGIAGAILGIGGGMIITPILTLGMGLNIKYAIGASIIAVIATSSGS
TIAYLRDNVLNLRVAMFLEIATTTGAIVGALLTGVLDPKYLYLLFGCLLVFSGWNMYRKL
RRGQEVLQRVEPDKIAAKLKLNGSYFDKAEMKNVDYQVEHVPAGFSVMFGAGVASGLLGI
GSGAFKVMAMDTFMKMPLKPSSSTSNLMMGVTAAASATVYFFNGAILPSIAVPMALGILG
GAVIGSRIMQVLPARWIRIVFIPIILYIGLEMLFKGLGVHF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaacagcgatactgatgcttgctgtaggtatttttgcaggcattgccggggct
attctcggcattggtggggggatgattatcaccccaattttaactttagggatgggatta
aatataaaatatgcgatcggtgccagtattattgccgtgattgcgaccagttcagggtct
acgatcgcttatcttagggataacgtactaaacttacgggtcgccatgttcttggaaatt
gcgacgacaaccggcgccattgttggcgcattgctgacgggtgtattagaccccaagtac
ctatatttactctttgggtgcttactcgtcttttcagggtggaacatgtaccgcaagtta
cggcgcggacaagaggttttgcaacgggttgagccggacaagattgccgcgaagttgaag
ctgaatggctcatacttcgacaaggctgagatgaaaaacgttgattaccaagtggaacat
gtgcccgctggtttttctgtgatgtttggtgccggagttgccagtggtctactgggaatt
gggtctggtgcgttcaaggttatggcgatggatacgttcatgaagatgccccttaaacct
tctagttcaacatctaatctgatgatgggcgtgacggctgccgctagtgccaccgtttat
ttcttcaatggggcgattttaccgagcattgcggtaccgatggcgctggggattttaggg
ggtgccgtgatcggttcgcgtatcatgcaggtcctaccggcgcgctggattcgcatcgtc
tttattccgatcattctctacattggattggaaatgttatttaaaggattgggggttcat
ttctaa

DBGET integrated database retrieval system