KEGG   Lactobacillus backii: AYR52_02870Help
Entry
AYR52_02870       CDS       T04754                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
lbt  Lactobacillus backii
Brite
KEGG Orthology (KO) [BR:lbt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lbt03019]
    AYR52_02870
Enzymes [BR:lbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     AYR52_02870
Messenger RNA biogenesis [BR:lbt03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     AYR52_02870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_anti-codon HD TraI_2 tRNA_anti_2 DUF2938 CDC24_OB3
Motif
Other DBs
NCBI-ProteinID: ANK60894
UniProt: A0A192H5Q4
LinkDB All DBs
Position
651092..652063
Genome map
AA seq 323 aa AA seqDB search
MAEKKLFDYQNNENVALFVVVKGAEVRLAKNGKKFIAFTFEDSSGQITAKFWDASETDIT
SFQAGKVVYLTGKRELYQGKPQIKLFKLRLAQEADHQTATDFLPKAPLSKSDLEQEINQA
VFAITNPNWNRIVRWILQRHQTEFFDYPAAKTNHHAFEGGLAFHTVTMLHLAQAICAEYS
FIKQPLLYAGIILHDMGKTIELSGAMATTYTLAGNLLGHIVLIDEEIVRACTALKIDPSS
EELLLLRHVILAHHGRKEYGSPVEPEILEAEVLHHIDDLDASIMMLQGTLEHTEPGNFSE
RIFGMDGRHFYRPEMKVIDPKTD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaaaaaagctttttgattaccaaaataacgaaaatgttgctctattcgttgtg
gttaagggtgcagaagttcgtttggctaaaaacgggaagaaattcattgcctttacgttt
gaagatagttctggacaaataacggccaaattttgggatgccagtgaaaccgatattact
agttttcaggcgggtaaggtagtctatttaactggtaagcgcgagttgtatcaaggaaaa
ccacaaattaaactgtttaaattacgattggcacaagaggcggatcatcaaactgcaact
gattttttaccgaaagcacctttgagtaagtcagatttagaacaagaaattaaccaggca
gtttttgcaattacgaatccgaattggaatcggattgttcgctggattttacaacggcac
caaacggaattctttgattatccggccgctaagaccaaccaccatgcttttgaaggcggt
ttagcgtttcatacggtcaccatgttacatttggcacaggcaatttgtgctgagtattca
tttattaaacaaccgttactgtacgcgggaattattttacatgatatgggtaaaacgatt
gaactatctggtgcaatggcaacaacttatacattggccggcaatttacttggacacatt
gttctgattgatgaagaaattgttcgggcttgtacggcacttaaaatcgatcctagtagt
gaagaattgctgcttttacgacacgtcattttggcgcatcatggccgtaaagaatatggt
tcaccagttgaaccagaaatattagaggccgaagtgctgcaccacattgatgatctagat
gcctcgataatgatgcttcagggaacacttgagcacacagaacctggtaatttttcagaa
cgaatttttggaatggatggccggcacttttaccgaccagagatgaaagtgattgatccc
aaaacggattaa

DBGET integrated database retrieval system