KEGG   Lactobacillus backii: AYR52_08275Help
Entry
AYR52_08275       CDS       T04754                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lbt  Lactobacillus backii
Pathway
lbt00473  D-Alanine metabolism
lbt00550  Peptidoglycan biosynthesis
lbt01100  Metabolic pathways
lbt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AYR52_08275
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYR52_08275
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AYR52_08275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lbt01011]
    AYR52_08275
Enzymes [BR:lbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AYR52_08275
Peptidoglycan biosynthesis and degradation proteins [BR:lbt01011]
 Precursor biosynthesis
  Amino acid ligase
   AYR52_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ANK60237
UniProt: A0A1Q8FBL2
LinkDB All DBs
Position
complement(1760151..1761224)
Genome map
AA seq 357 aa AA seqDB search
MQIYLIYGGHSAEHEISIASAFAVTQAIDYQQYSVIPIYISKDGLWLQGPELFAPVRQQL
NLQLKQGLTSRLSEQKKSSGIPFKFDRFKAADAIIFPLVQGKNGEDGKLQGLLETLRVPY
VGDGVLASAVGMDKIASKMIFQQINLPQVPYVAVLKNNWLANSEVILTRAEGSLLYPMYV
KPANSGSSVGISQVANRDELVEAIKVAFRYDQRILIEQGIEARELEVGLLGNGKIDVTPA
GEIMKDGLFFDYSSKFATKRPTLTIPADIDSKTQQAMQDYAKRAFAIIGGHGLARCDFFL
TANGDVFLNEINTVLDLSTDAMFPRLWQAAGMSFAQLVEELLELALEKFRQQPNKKK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttacttaatttatggtggtcatagtgccgagcatgaaatttcaattgcttcg
gcatttgctgtaacacaggccattgattatcaacaatattcagttattccaatctatatt
tcaaaggatggcttgtggttacaggggccagaactatttgcgcctgttcggcagcagctt
aatttacaacttaaacagggacttacttcgcgcttgagcgaacaaaaaaaatccagtggg
ataccttttaaatttgaccgtttcaaagcggccgatgcaattatttttccactagtccaa
ggcaagaatggtgaggacggtaaattgcagggattattagaaacgttacgggttccctac
gtcggtgatggcgttcttgctagtgcggtggggatggataaaattgctagtaagatgatt
tttcagcaaattaatttgccccaggttccttacgttgctgtcttgaaaaataactggcta
gccaattctgaggtgattttgacccgggcggaaggctctttactttacccaatgtacgtt
aagccggctaacagtggttctagtgtcggcattagccaagttgctaaccgggatgaattg
gttgaagcaatcaaggtagcttttcggtatgatcagcgaattttgattgagcaaggaatt
gaggcacgagaacttgaagtcggtttacttggaaatggtaaaattgacgtaaccccggcc
ggcgagattatgaaggatggcctcttttttgactatagcagtaaatttgcaacgaaaagg
ccaacactaactattcctgcagatattgattcgaaaacgcaacaggcaatgcaggattat
gctaaaagggcatttgcaattattggtggtcacggtttggcacgttgtgactttttctta
accgctaatggtgatgtttttttaaatgaaattaataccgttcttgatttatcaaccgat
gctatgtttcctcgattatggcaagcggcaggaatgtcttttgcacaattagtggaagaa
ttactagaattagccttagaaaagtttcggcaacaaccaaataaaaagaaatag

DBGET integrated database retrieval system