KEGG   Lactobacillus backii: AYR52_08380Help
Entry
AYR52_08380       CDS       T04754                                 

Definition
(GenBank) MFS transporter permease
Organism
lbt  Lactobacillus backii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 PTR2 OATP
Motif
Other DBs
NCBI-ProteinID: ANK60258
UniProt: A0A192H2X2
LinkDB All DBs
Position
1782717..1783898
Genome map
AA seq 393 aa AA seqDB search
MQKKTLSLKWLLLGSLITNTGISFIWPLTTIYMHEYLHESLTTAGIVLFADSLFMIIGNY
LGGLLFDRWNRYYTTLCGISLATIATGFLIFFHGWPAYPLFLILSGLGNGIVATCINSFA
TVVAGRPASYVFNLLYFTNNLGLVLGTLIVGFILPYGITYIFVLAFSLFALFLIVAAITY
RVDPIKNPINRAKAATQVLNRRSQHQIFLLLFTLFVTWVAYEQWQSNIAAYMVAHQMTVK
DYSLLWTFNAVLIVLLQPILTYFDQFLLKHLHGRMYLGFTLFASSFALLLIAKSYHLFIL
AMGVLTIGEILALPAVSTYVDQRVTLSQKGRYQGLVNVFASAGRAVGPLVGATIIESSSY
QLVFLLCVCSILLATVFFALGNRTTGEKQTNNQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaagacgctaagtttaaaatggctactattaggatcgctaatcaccaacact
gggattagttttatttggccactaacaacaatttacatgcatgaatacttgcacgaaagt
ttaactacggccggaattgttttatttgccgattcattatttatgatcatcggtaattac
cttggtggccttttattcgatcgctggaatcgttactacacgacgctttgtggtattagc
ttggctacgatcgccaccggttttttgatcttcttccacggttggcctgcctacccacta
tttctaattttatctggtttgggaaacggaatcgtggccacttgcattaattcttttgca
acggttgtggccggacgaccagctagctatgtctttaaccttttatactttacaaataac
ttaggccttgtcctaggaacgttgatagttggtttcattttaccctatggtattacctac
attttcgtcttagcgttcagtttattcgcgctatttttaattgttgccgccattacctac
cgcgttgatccaattaagaacccaattaatagggcaaaggccgcaactcaagtactcaat
cgacgcagtcaacaccaaatctttttgctattatttaccttattcgttacttgggtggcc
tacgaacagtggcaaagcaatattgccgcctacatggttgcccaccaaatgaccgttaaa
gattacagccttctttggacatttaacgccgtcttaattgttttattacagccaatttta
acttatttcgatcagtttttactaaagcatttacacggtagaatgtaccttgggtttaca
ctctttgcatcgtcttttgccttacttttaatcgccaaatcataccacctttttatttta
gcaatgggcgtcttaacgattggcgaaatactagcactacctgctgtttcgacctacgtt
gatcaacgtgtgaccttaagccaaaagggacgttaccaaggtcttgtcaacgtctttgct
tcggcgggccgcgcagttggtcctttagttggtgccacaattattgaatctagctcctac
caactagtcttcctactttgtgtgtgcagtatattactggccactgtgttctttgccttg
ggtaatcgaacaaccggcgaaaagcaaacaaataaccaataa

DBGET integrated database retrieval system