KEGG   Lachnospiraceae bacterium oral taxon 500: C3V36_10530Help
Entry
C3V36_10530       CDS       T05749                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lbw  Lachnospiraceae bacterium oral taxon 500
Brite
KEGG Orthology (KO) [BR:lbw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lbw01001]
    C3V36_10530 (pknB)
Enzymes [BR:lbw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C3V36_10530 (pknB)
Protein kinases [BR:lbw01001]
 Serine/threonine kinases: Other
  Bacterial family
   C3V36_10530 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Haspin_kinase Kinase-like YukC YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: AVM69641
UniProt: A0A2R3N1L0
LinkDB All DBs
Position
complement(2322537..2324432)
Genome map
AA seq 631 aa AA seqDB search
MLNKGDLINNRYEIIKRIGTGGMSDVYKAKCHKLNRYVAIKILKPELCEDENLVKRFKVE
AQAAAGLSHPNIVAVYDVGDEDDFHYIVMEYLEGKTLKTVIKERGVLTEAEIYHVASSVL
AALSHAHNNHIIHRDIKPQNIFWTKNNKVKVMDFGIARVITDKTIDMNETLTGSVHYISP
EQVKGLVQNEGSDIYSLGITMYEMATGEVPYDGDNPVNIALMHLDGKLPGICEKNPKISR
NFETIIYKATEKKTINRYATAKEMLTDLKAAYQHPEEVIEYTNNDNGATLVIPKNEIKQI
WSNKEYRSFGGEKDPYEKLIRWAAIVSAFVVVAILTAIIVPANIHNWVPKMVTVPDLFNL
NVEELSLRYPDLKYAIEGYVYSDEVTRGRIVEQDTKPLESVKAESIIGVIVSKGVEEKPV
PDVLNFSYSEAEKKLREQGFSVEQIIENNNTAAIGNVFRQSPAADSLLPKGGIVTIYVSK
GAEVELVEVPPLINQPKQEAIARLTELGFIVNVSESYNDHYEKGRVVMMSIAPGNKVVKG
SSIDLSVSLGKEFISKKMEIRINSPFGPVQESGIIKVTLTQGDTEKVLLETEVRIDQFPL
MLTPEGTGTGIITVYLDGVKQYTRQIVFTEE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgctgaataagggagatttaattaacaatcgttatgaaattatcaaacgaatcggcacc
ggcggcatgtcggacgtttataaggccaagtgtcataagctcaatcgttatgtggcgatt
aagattttgaaaccggaactgtgcgaagatgaaaatctggtcaagcgcttcaaggtggag
gcacaggctgcggccgggctgtcgcatcccaatatcgtggcggtttatgatgtcggcgat
gaggatgattttcactatattgtgatggaatatttagaaggcaaaactctgaaaacggtg
attaaagaacgcggggttttaaccgaggcggaaatttatcatgtcgcttccagtgttttg
gcggccttgtcgcatgctcataacaatcatattattcaccgtgacatcaagccgcaaaat
attttctggacgaaaaacaataaggttaaggttatggatttcggcattgcccgggtcatt
accgataaaaccattgatatgaatgaaactctgaccggatcggtgcattatatttccccg
gagcaggtcaaaggtctggtgcaaaatgaaggcagcgatatttactcgctggggattacc
atgtatgagatggcgaccggcgaggttccctatgacggggataatccggttaatattgcg
ctcatgcatttagacggcaagctccccgggatttgtgaaaagaacccgaagattagccgc
aactttgaaaccattatttataaagctacggaaaagaagacgattaaccgctatgctacg
gccaaggaaatgctgacggacctgaaggcggcgtatcagcatccggaggaggtaattgaa
tataccaataatgacaacggtgcgacattggtcatccccaaaaatgaaattaagcagatt
tggagcaataaggagtaccggagcttcggcggggaaaaggatccttacgaaaagctgatt
cgatgggcagcgattgtctcagcttttgtggtggtagcgattttgacggccattatcgtg
ccggccaatattcataactgggtgccgaaaatggtaaccgttccggatctttttaatttg
aatgttgaggaattgtcacttcgctatcccgatttgaaatatgctattgagggctatgtc
tacagcgatgaggttacccggggacggattgtcgagcaggataccaagccgctggaaagc
gtgaaagcggaatccatcatcggtgtcattgtcagcaagggcgttgaggaaaagccggtt
ccggatgtgcttaatttcagttacagtgaagcagaaaaaaagctgcgggaacaaggtttt
tcggttgagcagattatagaaaacaacaacacggcggccatcggcaatgtttttcgccag
tcgccggctgcggacagtctgctacccaaaggcgggattgtgactatctatgtcagcaaa
ggggcggaggttgaactggttgaagtgccgccgctgatcaatcagcccaagcaggaggca
attgcccgcctgacggaactgggctttatcgtcaatgtatcggaaagctataatgaccac
tatgaaaagggacgggtggtgatgatgagcattgctcccggcaataaggtagtgaaaggc
tcgtcgattgatttgtccgttagcttagggaaagagtttatttccaaaaaaatggaaatt
cggattaattcgccttttggaccggttcaggaaagcggtattattaaggtaacgctgacc
cagggagatacggaaaaggttctgctggaaacggaagtacggattgatcaattcccgctg
atgctgacgcccgaaggtaccggtaccggtattattacggtttatctggacggggtcaag
caatatactcggcaaattgtttttaccgaggaataa

DBGET integrated database retrieval system