KEGG   Leadbetterella byssophila: Lbys_1690Help
Entry
Lbys_1690         CDS       T01350                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lby  Leadbetterella byssophila
Pathway
lby00061  Fatty acid biosynthesis
lby00620  Pyruvate metabolism
lby00640  Propanoate metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
lby01212  Fatty acid metabolism
Module
lby_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lbys_1690
   00640 Propanoate metabolism
    Lbys_1690
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Lbys_1690
Enzymes [BR:lby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Lbys_1690
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Lbys_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 Oxidored_nitro ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADQ17397
UniProt: E4RZH3
LinkDB All DBs
Position
1768089..1769432
Genome map
AA seq 447 aa AA seqDB search
MFKKILIANRGEIALRIIRTCKEMGIKTVAVYSTADKDSLHVRFADEAVCIGPAPSKQSY
LNMQSIISAAEITNADAIHPGYGFLSENAEFSRICDAYKIKFIGASAEQINQMGDKATAK
ETMKKAGVPVIPGSDGLLSSVEEGKALAEEIGYPVIIKATAGGGGRGMRIIRHADEFQKH
WEDAKMESGAAFGNDGLYLEKFIEEPRHIEIQIVGDQYGNVSHLSERDCSIQRRHQKLIE
ETPSPIVSPELREQMGAAAVAGAKAIRYEGAGTIEFLVDKYGKFYFMEMNTRIQVEHPIT
EEVTGFDLIKEQIKVAAGEPVSGTHYYPNQYAMECRINAEDPKNGFRPSPGVIKQINLPG
GHGVRVDSHVYAGYVIPPNYDSMIAKLIVSAPTREEVIVRMKRALQEFFIDGIKTTIPFH
LKMMDDETFKSGYFNTGYLDNFDFSDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattcttatagccaacaggggggaaattgccctgcgcattatccgcacc
tgtaaggagatggggatcaaaacggttgccgtatattctacagcagataaagacagcttg
cacgtacgtttcgctgatgaagccgtatgtataggaccagctccaagtaagcagtcttac
ctaaacatgcaaagcattatatctgcagcagaaattacaaatgccgacgccatccatcca
ggatatggcttcctttctgaaaatgcagaattctcccgcatctgtgatgcgtacaaaata
aaattcattggtgcttctgccgagcaaatcaaccaaatgggcgataaagctactgcgaag
gaaaccatgaaaaaagcaggtgtacccgttattccaggttctgacggacttctatcttca
gtggaagaaggaaaagccctagcagaggaaattggttatcctgtgatcatcaaagctact
gccggtggtggcggtagaggtatgagaatcattcgtcatgcagacgagttccaaaaacac
tgggaagatgctaagatggaatcaggtgcagccttcggaaatgacggcctttaccttgag
aaattcatcgaagaaccgcgccatatcgaaattcagatcgtaggtgaccagtacggcaac
gtatcccacctatctgaacgtgattgctctatacagagaagacaccaaaagctgatagaa
gaaactccttccccaatagtttctcctgaattaagagaacaaatgggtgcagcagccgta
gccggagcgaaagcaattcgctacgaaggtgccggaactatagaattcttagtggacaaa
tacggcaagttctatttcatggaaatgaacacccgtattcaggtagaacaccctatcacg
gaagaagtgaccggatttgacttgatcaaagaacaaatcaaggtagccgcaggtgagccg
gtatctggtacgcattactaccctaaccagtacgctatggagtgtaggatcaatgctgaa
gatcctaaaaatggcttccgccctagccccggtgttattaaacaaattaatctaccggga
ggacatggagtacgcgtagactcgcatgtatatgcaggatatgtgatccctcctaactat
gattccatgatcgcgaaactaatcgtttccgcgcctacaagagaagaagtaatcgtaaga
atgaaacgtgcactgcaagagtttttcattgacggaatcaaaactaccattcctttccat
ttgaagatgatggacgatgaaacctttaagtccggatatttcaataccggttatttagat
aatttcgatttctccgacttataa

DBGET integrated database retrieval system