KEGG   Leadbetterella byssophila: Lbys_2010Help
Entry
Lbys_2010         CDS       T01350                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lby  Leadbetterella byssophila
Pathway
lby00620  Pyruvate metabolism
lby00680  Methane metabolism
lby01100  Metabolic pathways
lby01120  Microbial metabolism in diverse environments
lby01200  Carbon metabolism
Module
lby_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lbys_2010
  Energy metabolism
   00680 Methane metabolism
    Lbys_2010
Enzymes [BR:lby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lbys_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADQ17706
UniProt: E4RSH0
LinkDB All DBs
Position
complement(2143147..2145699)
Genome map
AA seq 850 aa AA seqDB search
MPTQNLEAIFTQEVHNKYLVFNTLFSRLPYDKMAKIGSLMPFLYDNAKQGFDEGKTPKEI
IDAFFEKFTVISTEKEKIDLLFRLISYVERQVVLFDSVEDAAFEKLTPQDSPGTLKAILA
LARQYDKKEEVREKLRNFKVRVVFTAHPTQFYPNSVLRIIQDLEQYILVNDINAIDQLLQ
QLGKTPFFNSEQPTPVQEAQSIIFYLRHVYYEVLSQIQEVVSQEIFEGEDISPVIELGFW
PGGDRDGNPFVTADITRKVAQELRSNILKCYYNHFKSIRRRFTFKGVIPLLDKINNKIYT
NMFGLNNDLSYNALISRLEEVREVMVTQHSSMFLDELDRFIRRVKLFGLHFATLDIRQDS
SIHEKVMQAVNEKFKVSPVPYSEWTHDQKVEFLTTSTIEVWEDDFTDPLVKDTFKTIRVI
KEIQAHNGENACNRYIISNSTSACSVLEVLALFKFCGYRDADISVDIIPLFETIEGLDSA
KETMEELYNNLAYRRHLNIRRNTQTIMLGFSDGTKDGGYIKANWEIFRAKERLSAVSKEN
EVSVIFFDGRGGPPARGGGKTHQFYASQGPTIANNQIQVTIQGQTITSMYGSRPQARFNF
EQLLTAGVLNDVFGDQRANISEKDRALIEEMAEIGGKKYLELKNHKLFVPYLENKSPLKY
YGQTNIGSRPSKRSTGGKLKLSDLRAIPFVGAWSQLKQNIPGFYGLGTAMEKIIQSGREK
ELRELYNGSLYFKTLIQNSMMAMSKTYFPLTSYMKEDKEYGELWKIMYEEYEKSVKYMLA
ISDQKTLMETEVVGSLSVNYREQIVLPLLAIQQYALQKIEETTDEELKKVYQKMVTRSLF
GNINASRNSA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacaaaatctagaggccatatttacacaggaggtgcacaataagtacttggta
tttaataccctcttttctaggttgccttatgataaaatggctaaaatagggtcgttgatg
ccatttctttatgataatgcaaagcaaggttttgatgaaggaaagacgcctaaagaaata
atagacgctttctttgagaagtttacggtgataagcacagagaaggagaagatagatctt
ttattccgcctgatcagttatgtagaacgtcaagttgtattatttgatagtgtagaagat
gcggcctttgaaaagctaacccctcaagattcgccgggtacgctgaaggctatcttagct
ttggctagacaatacgataaaaaagaggaggtaagagagaagttaagaaactttaaggtt
agagtagtattcactgctcaccctacgcagttttatccgaactccgttttaagaatcatt
caggatttggaacaatatatcctggtgaatgatatcaatgctattgatcagctattgcaa
caactaggaaagacgccattctttaatagcgaacaacctacccctgtacaagaggctcag
agtatcattttctatttacgtcatgtatactatgaggttttgtcccaaatccaggaagtg
gtttcacaagaaatctttgaaggagaagatatttcgccggtcatagagctgggattctgg
ccgggaggagacagagacggtaatccctttgttacggctgatatcacccggaaggtggcc
caagagttacgctcgaacatcctaaaatgttattataatcacttcaagagtattcgaaga
cgattcaccttcaagggggttattccacttttggacaagatcaataataagatctatacc
aatatgtttggtcttaataatgacctctcttataatgctttaataagtagattagaggag
gtaagggaagtgatggttacccagcatagtagtatgttcttagatgagttagatcgattt
atcaggagggtgaaactttttggtttgcattttgccaccttggatatccgtcaggacagc
agtatccatgaaaaggtgatgcaggcagtaaacgagaagttcaaggtttctcctgtacca
tattctgaatggacacatgatcagaaggtggaattcttaaccaccagtaccatagaggtt
tgggaggatgatttcacggatccattggtaaaagataccttcaagactatacgtgtgatc
aaagaaattcaggctcataacggtgagaatgcttgtaatcgttatatcatatccaattct
acttcagcttgttccgtacttgaagtattggctctgtttaaattctgcggctatagagat
gctgatatttctgtggatattatacctctttttgaaaccatagaagggttggattccgcg
aaagagaccatggaagagctctataataacttagcttatagaagacatttaaacatcaga
agaaatacacaaaccatcatgcttggtttctcagatggaacaaaggatggagggtatatt
aaggcaaattgggagattttccgtgcgaaagaaagactttctgctgtatccaaagagaat
gaagtgagtgtcattttctttgatggtaggggaggtccaccggctcggggaggaggtaaa
acccaccagttttatgcctcacagggtcctacaattgccaataatcagattcaggtcacc
atacaggggcaaaccatcacttcaatgtatggttccagacctcaggccagatttaatttc
gagcaattgctaactgcaggtgttctaaatgatgtattcggggatcagagggcaaatatc
tctgagaaggatagggctttgattgaagaaatggcggagataggaggtaagaaatatctg
gaattgaagaatcataaactctttgtcccttatctagaaaataagagtcctctgaaatat
tatgggcaaaccaatattggaagtcgacctagcaagagaagtaccggtggtaagctaaag
ctttcagatcttcgtgctatcccatttgtaggggcatggagccagttgaaacaaaatatc
ccgggcttctatggtttgggtacggctatggaaaagatcattcaaagcggtagagaaaag
gagttaagagaactttataatggttcactctacttcaagaccttgatccaaaacagtatg
atggccatgtcaaagacctatttcccattgacctcttatatgaaagaggacaaagaatac
ggagagctttggaagatcatgtatgaggaatatgagaaaagtgtaaaatacatgttagcc
atctctgatcaaaagaccttaatggaaacggaggtagtaggctcattgtcggttaactat
agagaacaaatcgtcttgcctttgttggctatccaacaatacgccttgcagaagattgaa
gaaaccacagatgaggaattgaagaaggtgtaccaaaagatggttacccgctccttattt
gggaatattaatgcaagtagaaattcagcatag

DBGET integrated database retrieval system