KEGG   Leadbetterella byssophila: Lbys_3538Help
Entry
Lbys_3538         CDS       T01350                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lby  Leadbetterella byssophila
Pathway
lby00473  D-Alanine metabolism
lby00550  Peptidoglycan biosynthesis
lby01100  Metabolic pathways
lby01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Lbys_3538
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lbys_3538
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Lbys_3538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lby01011]
    Lbys_3538
Enzymes [BR:lby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Lbys_3538
Peptidoglycan biosynthesis and degradation proteins [BR:lby01011]
 Precursor biosynthesis
  Amino acid ligase
   Lbys_3538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ADQ19186
UniProt: E4RZ68
LinkDB All DBs
Position
complement(3985536..3987293)
Genome map
AA seq 585 aa AA seqDB search
MDKKIKVGIFFGGQSREREISFLGGRTAYEHLDKRFFEPVLIFVDSLGNFIHVEPSILNE
ADIRSFYPSKNQNNGYKVYIESLGPLKVSQLYKLIYKIGSQVKIEELKSYMDFAFVVMHG
PSAEDGSIQGLLEWLNIPYLGPGILGSAVGINKPFQNKLMAYATGQEKKYLTISKREWNT
SDRSKLFSSVIAKLGFPFVVKAPHQGSSIGVAIVRKRSLEEFSKAMSQCFFETFITKKEW
DKLSPRRKKNVMEKMSNLDEGIGFPVVLDGEQIYHPATLLKKLDEYLTQHEVAQLNSVNG
EDYVLIEEFISGQEFSCGVIQDDEGRVLPLPPAEVYGETATFDFKAKYKSTVSKKRIPVK
TSDANLEKIHEDVLKAFEATGMSVICRIDGFITEDDVVVLHDPNTLPGMSPSSFIFKQMA
EVGFNITNSLTYFIRQSLIERIRSGKNQFEVQQLLNHLSTQIKNAPARKRLAVLFGENEK
EFILAKKVYNELCGSEEYEPVPVCAALNGSRYIIPLNLMYKPDINEFGTAIATPKHPFIQ
KNIELVKQVRAFYAGEVDFSVRKVSEQDYNQIFKHTYDCLTGELH
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaattaaagtaggaattttttttggtggacagtcgagagaaagagaaatt
tctttcctcggtggacgtaccgcttatgagcatctggacaaacgcttttttgagccggtt
cttatctttgtagatagtttaggcaactttatacacgtagaaccttccatcttaaacgaa
gctgatattcgtagcttctacccttccaagaatcagaataatggatacaaagtttatata
gaatctctgggaccattaaaagtctctcagttgtataaactcatctataaaataggctca
caagtcaaaatagaagaattaaagtcctatatggactttgcatttgtagtaatgcatggc
ccatctgctgaagatggcagcatccagggtctattagagtggctgaatattccttacctg
ggccctggcatattaggttcagctgtaggcataaacaagcctttccaaaacaaactgatg
gcctatgctacgggccaggaaaagaaatatcttaccattagcaaaagagaatggaatact
agtgatagatctaaactattctccagtgtaattgcaaaacttggatttccatttgtagtt
aaagctccgcatcaaggatcttctataggagtagctatagtgcgaaaaagaagtctggaa
gaattctccaaagccatgtcccaatgcttctttgaaacctttataacaaagaaagaatgg
gataaactttctcctcgcagaaagaaaaacgtcatggagaagatgagcaatctggatgag
ggcataggttttccagtagtcttagatggagagcaaatctaccatccagctacacttcta
aagaagttagacgagtacttgactcagcatgaagtagcgcagctaaacagcgtaaacgga
gaagactatgtcttgattgaagagtttatcagcggtcaggaattctcttgcggagttata
caagatgacgaaggtagagttctacctttacctcccgctgaggtatatggagaaacggcc
acttttgactttaaagccaaatacaagagcactgtcagcaaaaagcgaataccggttaaa
acctctgatgctaacctagagaagatacatgaagatgtattaaaagcattcgaagccaca
ggtatgagcgtgatttgcagaattgatggtttcattacagaagacgatgtcgtggttcta
catgacccgaataccttaccgggaatgtctccatcttccttcatctttaaacaaatggcg
gaagtaggatttaatatcaccaactctctgacatacttcattcgtcaatctctaattgaa
agaataagaagcgggaaaaatcagtttgaagtacagcaacttctaaaccaccttagtacc
caaatcaaaaacgctcccgctcgtaagcgccttgccgtactatttggagaaaacgaaaag
gaattcatactggcgaagaaagtatacaatgaactttgcggaagcgaggaatacgaacct
gtaccggtatgtgctgcattaaacggatccagatatattattcctctgaatctaatgtac
aagccagatatcaatgaatttggtacggctatagccacgcctaagcaccctttcattcag
aaaaacattgaactggtaaaacaagtgagagcattctatgctggggaagtggacttctcc
gtaagaaaggtttcagaacaggattataaccaaattttcaaacatacatacgactgtcta
accggagaactgcattga

DBGET integrated database retrieval system