KEGG   Leishmania braziliensis: LBRM_21_0310Help
Entry
LBRM_21_0310      CDS       T01113                                 

Definition
(RefSeq) putative hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00051  Fructose and mannose metabolism
lbz00052  Galactose metabolism
lbz00500  Starch and sucrose metabolism
lbz00520  Amino sugar and nucleotide sugar metabolism
lbz00524  Neomycin, kanamycin and gentamicin biosynthesis
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
Module
lbz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_21_0310
   00051 Fructose and mannose metabolism
    LBRM_21_0310
   00052 Galactose metabolism
    LBRM_21_0310
   00500 Starch and sucrose metabolism
    LBRM_21_0310
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_21_0310
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBRM_21_0310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lbz04131]
    LBRM_21_0310
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     LBRM_21_0310
Membrane trafficking [BR:lbz04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    LBRM_21_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 5415296
NCBI-ProteinID: XP_001564741
UniProt: A4HBM3
LinkDB All DBs
Position
21:83616..85031
Genome map
AA seq 471 aa AA seqDB search
MASRVNNLMNHLAIRDSDSEEMRYIKQRLALASLSTQFTMASEKMKQLTMYMVYEMVEGL
EGRPSTVRMLPSYVYTSDPAKATGVYYALDLGGTNFRVLRVSLRSGKVDDRIDSKFVIPK
SALTGNSANLFDFIAQSVKKMMSENAPEDLEKRVPLGFTFSFPVDQKAVNKGLLIKWTKG
FSTKNVEGNDVVELLQGSLRRMHINVNVVALCNDTVGTLVARYFVDTNAQVGVIIGTGSN
ACYFERASAVTKDPAVCARGNAVTPINMECGNFDSKYKYALPTTVYDDEMDAITPNRDHQ
RQEKIVSGMYLGEISRRMIVHLAQLGCLPRDLVDGLGKPWAFESKHMGMVAADQMPGLQF
TRELIKRVAGVNVTDVADLHTIREICCLVRNRAAQQAAVLSAAPMLKTRTQGLATVAVDG
SVYEKVPSFQRLYQECITGILGPTSNAKVVLQKDGSGVGAAMICALAANQK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccgcgtgaataacctcatgaaccacctcgctatccgcgactcggacagcgag
gagatgcgctacatcaagcagcgcctcgcgctcgcctccctctccacccaattcaccatg
gcctcagagaagatgaagcagctcaccatgtacatggtgtatgagatggtcgagggtctt
gagggtcggccgagcaccgtgcgcatgctgccgtcctacgtgtacacgtctgacccagcc
aaggccacgggtgtgtactacgcgctcgacctcggtggcacgaacttccgcgtactgcgc
gtgagcctgcgcagcggcaaggtggacgaccgcatcgactcgaagttcgtcatcccgaag
agcgccctgactggcaattccgcgaacctgttcgacttcattgcgcagagcgtgaagaag
atgatgtcggagaatgcccccgaggacctggagaagcgcgtgccgctcggcttcacgttc
tccttcccggtggaccagaaggccgtcaacaagggtctgctgatcaagtggacgaagggc
ttctcgacgaagaacgtggagggcaacgatgtggtggagctgctgcaggggtcgctgcgc
cgcatgcacatcaacgtgaacgttgtggcgctctgcaacgacaccgtcggcacgctggtg
gcgcgctacttcgtcgacacgaacgcgcaggtcggcgtcatcatcggcactggctccaac
gcctgctactttgagcgcgcctcggccgtcacgaaggaccccgccgtgtgtgcccgcggc
aacgccgtcacgccgatcaacatggagtgcggcaacttcgactccaagtacaagtatgcg
ctgcccaccaccgtgtacgacgacgagatggacgcgatcacccccaaccgcgaccaccag
cgccaagagaagatcgtctctggcatgtacctcggtgagatcagtcgccgcatgatcgtg
cacctggctcagctcggctgcctgccccgcgatctggtggacggtctgggcaagccgtgg
gcgttcgaaagcaagcacatgggcatggttgccgccgatcagatgcccggcctgcagttc
actcgcgagctcataaagcgcgtcgctggtgtgaatgtgaccgatgtagccgacctgcac
acgattcgcgagatctgctgcctggtgcgtaaccgtgctgctcagcaggccgctgttctt
agtgctgctccgatgctcaagacccgcacgcagggcctcgccaccgtcgctgtcgacggc
tccgtgtacgagaaggtgccgtccttccagcgcctgtaccaggagtgcataactggcatc
ctcggccccacatcgaacgcgaaggtggttctgcagaaggacggtagcggtgtcggcgcc
gcgatgatctgcgcactggccgccaaccagaagtag

DBGET integrated database retrieval system