KEGG   Leishmania braziliensis: LBRM_24_1690Help
Entry
LBRM_24_1690      CDS       T01113                                 

Definition
(RefSeq) putative succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00020  Citrate cycle (TCA cycle)
lbz00190  Oxidative phosphorylation
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBRM_24_1690
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LBRM_24_1690
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LBRM_24_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5416013
NCBI-ProteinID: XP_001565433
UniProt: A4HDM3 A0A3P3Z888
LinkDB All DBs
Position
24:590486..592309
Genome map
AA seq 607 aa AA seqDB search
MLRRTFARLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLMMEDGCCRGVMAMSIDDGTIHRFKAKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVV
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVISPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPDLRADSGEVSIADLDRILSNNGDIPIARIRERMKETM
ALYAAVFRTEENMQTGKRIIEECYRDFSHALVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYPERDDHSWMKHTLAYLDDAKGEVRLAYRPVHMETLTNEVDSI
PPAKRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgtacctttgcgcgtctcgccctgagccgcgcttacccagtcatcgaccac
acgtacgactgcgtcgtcgtgggcgccggtggctctggtctccgcgctgccatgggtgtg
gcggcttctggctacgatgtggcgtgcatctcgaagctgtacccgtctcgctcgcacacg
atagcagcgcagggtggcattaacgctgccctcgcgaactgcgaggaggatgactggcgc
tggcatgtatacgacacggtaaagggctcggactggcttggcgaccaggatgcaatccag
tacatgtgccaggaggccccgtgcgttgtgtcggagctggagagcatgggcttacccttc
ctgcgtacgaaggatggcttcatctaccagcgcgcctttggtggccagtcgattcactac
ggtggcaaacaggcgcgtcgcacgtgcgctgcgtcggaccgcacgggccacgccatgctt
cataccctgtacggccagtccttccagtacggcgtgaacttctacaacgagtactattgc
cttgacctgatgatggaggacggctgctgccgcggtgtgatggccatgagcatcgacgac
ggcacgatccaccgcttcaaggccaagtacacggtgctctgcacgggtggctacggccgc
gtgtacttcacgacgacaagcgcgaagagctgcacgggcgacggcacggccatggtggtg
cgcgccggcctgccggcggaggacatggagtttgtgcagttccaccccaccggcatctat
ggccctggcgtgctcattactgagggagcgcgcggcgagggtggctaccttgtgaacagc
gagggtgagcgtttcatggagcgctacgcccccaaggcgaaggatctggcgtcgcgcgat
gtcgtgtcgcgtgccattacgatggagatcctggcgggtcgtggctgcggccccaagaag
gaccacgtaatgctgcagctgcaccacctcgaccccgccaccttgcacaagaagttgccg
ggtatctcggagagcgctcacatcttcgccggcgttgatgtgaccaaggagccgattccg
attgtgccaacagttcactactcgatgggcggcgtgccgacactgtggacgggggaggtg
atcagcccgcgaaatggtgacgacaacgcgattgtacctggcctgctcgcagccggcgag
tgcgcgtgcgctagcgtgcatggcgccaaccgcctcggcgcgaattcgctgctggacatc
gtcgtgtttgggaagtcttgcgcgaacaccgtcatcttcaatctgacaaaggagggccgc
aagcagcccgacctgcgagccgactccggcgaggtctccattgctgatctggaccgcatc
ctcagcaacaatggcgacatccccatcgcccgcatccgtgagcgtatgaaggagacgatg
gcgctttacgccgccgtgttccgcacagaggagaacatgcaaaccggcaaaaggatcatc
gaggagtgctaccgagacttctcccatgccttggtgcacgacaagtcgccggtgtggaac
agcaacctgattgaggccctcgagctgcgtaaccttctgacgaatgccatgatgacgatt
agcggcgctgtggtgcgcaaggagagccgcggcgcccacgcgcgcgacgactacccggag
cgtgacgaccacagctggatgaaacacacactcgcctacctcgacgacgccaagggcgag
gtacgccttgcgtaccgcccagtgcacatggagacgctgacaaacgaggtggacagtatc
ccgccggcgaagcgagtgtactag

DBGET integrated database retrieval system