KEGG   Leishmania braziliensis: LBRM_25_1100Help
Entry
LBRM_25_1100      CDS       T01113                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00053  Ascorbate and aldarate metabolism
lbz00071  Fatty acid degradation
lbz00280  Valine, leucine and isoleucine degradation
lbz00310  Lysine degradation
lbz00330  Arginine and proline metabolism
lbz00380  Tryptophan metabolism
lbz00410  beta-Alanine metabolism
lbz00561  Glycerolipid metabolism
lbz00620  Pyruvate metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_25_1100
   00053 Ascorbate and aldarate metabolism
    LBRM_25_1100
   00620 Pyruvate metabolism
    LBRM_25_1100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBRM_25_1100
   00561 Glycerolipid metabolism
    LBRM_25_1100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBRM_25_1100
   00310 Lysine degradation
    LBRM_25_1100
   00330 Arginine and proline metabolism
    LBRM_25_1100
   00340 Histidine metabolism
    LBRM_25_1100
   00380 Tryptophan metabolism
    LBRM_25_1100
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBRM_25_1100
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LBRM_25_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LPD7
Motif
Other DBs
NCBI-GeneID: 5416199
NCBI-ProteinID: XP_001565614
UniProt: A4HE56
LinkDB All DBs
Position
25:complement(432537..434036)
Genome map
AA seq 499 aa AA seqDB search
MLRATLTRLEVAPKVTHIQDKLLINGKFVSAMSGKTFEVVNPANEKVIATVAEAGKADVD
LAVKAARHAFESFRTTDCHWRRNLMLRLADILEKNGKEMAALESLDNGKPYEVALNVDVA
LSVECFRYCAGFADKVDGSVPPRSGNFLGVVKRQPIGVCGQIIPWNFPLLMAAFKLSPAL
ALGNAVVLKPAEQTPLSALRLGEMVMEAGFPDGVLNILPGFGATAGAEIARHMDVDKVAF
TGSTAVGREVMRMAAETNLKKVSLELGGKSALIVCEDADVEEAAQVATTGVYFNTGQVCT
ASSRIYVHESVYDQFVSCLRRNAEACKVGPGNNTANNMGPLVSKKQQERVLGYIDDGVKA
GATVVTGGKKIGDTGYFVQPTIFADVKEDMRICKEEIFGPVTCVMKFKDMDEVVKRANDT
IYGLAAGICTRSMDTALRYSTYLNAGTVWVNTWNNFCATMPFGGFKQSGIGRELGKDAIE
LYTEPKAIHFALKGPIVKP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgcgaccctcactcgcctggaggtggcccccaaggtcacgcacattcaagac
aagctgctgatcaacggcaagttcgtgtcagccatgtctggtaagacgtttgaggttgtg
aaccccgcaaacgagaaggtgatcgcgaccgttgcggaggccgggaaggcggatgtggac
cttgcggtgaaggctgcccgccatgccttcgagtctttccgtacgaccgactgccactgg
cgccgcaatctgatgttgcgtctggcagacatcctggagaagaacggcaaggagatggct
gcactggagagcctggacaacggcaagccgtacgaagtagcgctgaacgtggacgtggca
ctttctgtcgagtgctttcggtactgcgctgggttcgcggacaaggtggatggcagcgtg
ccgccgcgctccggcaacttccttggtgtcgtgaagcgccagccaatcggcgtgtgcggc
cagatcatcccgtggaacttcccgctactgatggctgccttcaagctcagccctgcgctt
gctttgggcaacgcggttgtgctaaagcccgcggagcagacgccactgagcgcgctgcgg
cttggcgagatggtgatggaggctggcttcccggacggcgtgctgaacatcctgccaggc
ttcggcgcgactgccggtgcggagattgcgcgtcacatggacgtggataaggttgccttc
accggctcgaccgctgttggccgagaggtgatgcggatggcggcggagaccaacctgaag
aaggtgtcactggagcttggcggcaagtctgcgctgatcgtgtgcgaggacgccgatgtg
gaggaggcggcgcaggtggccaccactggcgtctacttcaacacgggccaggtgtgcacg
gcgtcgtcacggatttacgtgcacgaatcggtgtatgaccagtttgtgtcgtgcctgcgc
aggaatgcagaggcgtgcaaggtgggaccaggaaacaacacggcgaacaacatgggcccg
ctggtctcgaagaagcagcaggagcgcgtactcgggtacatcgacgacggcgtgaaggct
ggcgcgacggtggtgactggcggcaagaagatcggtgacacgggctacttcgtgcaaccg
accatctttgcagacgtgaaggaggacatgcggatctgtaaggaggagatcttcggcccc
gtaacttgcgtgatgaagttcaaggacatggatgaggtcgtgaagcgcgcgaacgacacc
atctacggactggctgccggcatctgcacgcgcagcatggacactgcgctccgctactcc
acatacctcaacgccggcacggtgtgggtgaacacctggaacaatttctgcgccacgatg
ccgtttggcggcttcaagcagagcggcattggccgcgagctgggcaaggacgccattgag
ctgtacacggagccgaaggcgatccactttgccctcaagggacctatcgtcaagccgtga

DBGET integrated database retrieval system