KEGG   Leishmania braziliensis: LBRM_32_4080Help
Entry
LBRM_32_4080      CDS       T01113                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K20368  protein cornichon
Organism
lbz  Leishmania braziliensis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lbz04131]
    LBRM_32_4080
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbz02000]
    LBRM_32_4080
Membrane trafficking [BR:lbz04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    LBRM_32_4080
Transporters [BR:lbz02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   LBRM_32_4080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 5418688
NCBI-ProteinID: XP_001567756
UniProt: A4HL21 A0A3P3ZF72
LinkDB All DBs
Position
32:1504109..1504675
Genome map
AA seq 188 aa AA seqDB search
MSSTKRLTDAFRLQFQWVPVLITDRSHHTSGERKRSVLFAVLHVTFLLVLCGHFVNVMAS
WVLAFILQTGAMGLCVLHLTILEEYADRMNKSLELEHVINPLIIAEASVRCFACLQCVLS
RSWLLLLAGCVEIAYDVYVVQHRSLLIDGTTIWKEVDIFRTDGRLRVAYQLLMIPVCLLY
LIFSIYSS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcacaaagcgtctcactgatgccttcaggcttcagtttcagtgggttccggtg
ctcatcaccgatcgaagccatcacacaagcggagaacgcaaacgctccgtcctgtttgcg
gtgctacatgtcacgttcctgctggttttatgtggccactttgtgaacgtaatggcttcg
tgggtgctcgcgttcatcctgcagaccggagcgatggggctgtgcgtgcttcatctcacc
atacttgaagaatacgcggatcgaatgaacaaatcactggagctagagcacgtgatcaac
cctctcatcatcgcagaggcctccgtacgatgctttgcttgcctgcagtgtgtcctcagt
cgctcgtggctacttctccttgctggctgcgtagagattgcgtacgacgtctacgtggtg
cagcaccgctctctgctgatcgacgggacgacgatttggaaggaggttgatatctttcgc
actgatgggcggctccgtgtggcatatcagctgttgatgattcctgtctgcctcttgtac
ctcatcttttctatttacagctcgtaa

DBGET integrated database retrieval system