KEGG   Lactobacillus paracasei ATCC 334: LSEI_0143Help
Entry
LSEI_0143         CDS       T00407                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00473  D-Alanine metabolism
lca00550  Peptidoglycan biosynthesis
lca01100  Metabolic pathways
lca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LSEI_0143
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LSEI_0143
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LSEI_0143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lca01011]
    LSEI_0143
Enzymes [BR:lca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LSEI_0143
Peptidoglycan biosynthesis and degradation proteins [BR:lca01011]
 Precursor biosynthesis
  Amino acid ligase
   LSEI_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-GeneID: 4421584
NCBI-ProteinID: YP_805449
UniProt: Q03CR5
LinkDB All DBs
Position
complement(143909..144982)
Genome map
AA seq 357 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVEQVFDDANT
SKDLNISDAILTDEDINKLRPDGSTQLFGPNVMAICKAADIVFLALHGGDGENGKVQAVF
DINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFDFPVVVK
PTSGGSSVGTHIIHNQEELESGLEDVFRFDNSAIVEEFTPGREFSLGVVNGHAYSAIEIK
VRSGWYDFKHKFQAGYTDFITPPKDLDEDVHQAMKDVAVQTMDVLGLQNYGRIDFFANEK
GVWVIEANNLPGMTPLSLLPQEAEADGVDYGDLVMDIVNGKLKLYADGMTEAGLLTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggagcgcaatgtgtccatttctagc
ggctaccggatcacgaacgccttgcggcaaaaagggcagcaggccacctttattgacctg
tttcttggctacgacctcgaagggaagacggtcgaacaggtttttgatgacgccaacacc
agcaaggatctgaatatttcagatgcgattctgactgatgaagacatcaataagttacgg
ccagatggcagcacccagctatttggtcccaatgttatggcgatctgcaaagcagcggac
attgttttcctcgctttgcatggtggcgatggcgaaaacggtaaggttcaggctgtgttt
gacatcaacggggtcaagtatactggctctggcccgctggcttcaggcatcaccatgaac
aaggttttcagtaaggaagtcatgttgtatcatggcattcagacttcaggattcaaggaa
ttcaagcgcgatcaagggccaaaacaaacggtcccgtttgattttccagttgttgtcaag
ccaacatccggcggttccagcgttgggacacatatcattcataatcaggaagaactcgaa
agtggtcttgaagatgttttccgcttcgacaacagtgccattgttgaagagttcacccca
ggtcgcgaattctcgttaggcgttgtcaatggccacgcttactcggccatcgaaatcaag
gtgcgttctggttggtatgatttcaagcataaattccaagccggctacaccgacttcatc
accccgccaaaggatctcgatgaagatgtccatcaggctatgaaagatgttgccgtccaa
acgatggatgttctgggcctgcaaaattacggccgaattgacttcttcgccaacgaaaaa
ggtgtttgggtcattgaagccaacaacctgccggggatgacaccactgtcactgttgccg
caagaagccgaagcagacggtgttgactacggcgatttggtgatggatattgtcaacggc
aagctcaagctctacgctgacggcatgaccgaggctggactcttaacgaagtaa

DBGET integrated database retrieval system