KEGG   Lactobacillus paracasei ATCC 334: LSEI_0601Help
Entry
LSEI_0601         CDS       T00407                                 

Definition
(RefSeq) amino acid ABC transporter periplasmic protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LSEI_0601
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lca02000]
    LSEI_0601
   02035 Bacterial motility proteins [BR:lca02035]
    LSEI_0601
Transporters [BR:lca02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    LSEI_0601
Bacterial motility proteins [BR:lca02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    LSEI_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd Nitrate_red_gam
Motif
Other DBs
NCBI-GeneID: 4419275
NCBI-ProteinID: YP_805887
UniProt: Q03BH7
LinkDB All DBs
Position
complement(591034..591846)
Genome map
AA seq 270 aa AA seqDB search
MLKKKLWVLLPIVALSAFILTACSSSKADSSKTSTVTSELINKNELTIGLEGTYAPFSYR
KDGKLQGFEVDLGKALAKKVGVKAKFVPTQWDSLIAGLGSQKFDLVLNNISETPQRKKVY
NFTTPYMYSRYALITRSDETSIKGLNDIKGKTFVEGTGTPNAALAKKYGANITPSGDFTV
SLNLVKENRADGTINATAAWYAYAKSNSTTGLKSQTLKDSDVKPDEVAGMISKKSPNLQK
ALSKGIQELRSDGTLKKLSEKYFGADLTTK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaaaaagttgtgggtcttattaccaattgttgccctttccgcgttcattttg
acagcttgctctagtagtaaagctgacagcagtaaaacaagcacggtcacgagcgaactt
atcaataaaaatgagttgaccatcggcctcgaaggcacttatgcgcccttctcttatcgc
aaagatggcaagctgcaaggcttcgaagtcgatcttggcaaggctctagccaagaaagtc
ggcgtcaaagccaagtttgttcctacccaatgggattccctgatcgctggccttggaagt
caaaagttcgacctcgtgctcaataacatcagtgaaacaccccagcgtaagaaagtttac
aacttcaccacaccgtacatgtactcccgatatgctttgatcactcgcagcgatgaaacc
tcgattaagggtttgaacgacatcaaaggcaagacttttgttgaaggcactggcacccca
aatgctgccctagctaaaaaatacggtgccaacattacaccttctggcgacttcactgtt
tcgctcaatctggttaaggaaaatcgtgcagatggcaccatcaacgccaccgccgcctgg
tatgcctacgctaagagcaattccacaaccggtttaaagagccagacacttaaagatagc
gatgtgaagcctgacgaagtggctggaatgatcagtaagaaatcgcctaacttgcagaaa
gccttatccaaaggcattcaggaacttagaagcgatggcactttaaagaaattgtctgag
aaatactttggcgctgatttaaccactaaataa

DBGET integrated database retrieval system