KEGG   Lactobacillus paracasei ATCC 334: LSEI_0661Help
Entry
LSEI_0661         CDS       T00407                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00564  Glycerophospholipid metabolism
lca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LSEI_0661
Enzymes [BR:lca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LSEI_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 4419248
NCBI-ProteinID: YP_805944
UniProt: Q03BC0
LinkDB All DBs
Position
complement(662408..664261)
Genome map
AA seq 617 aa AA seqDB search
MVFSNETRKQTIHQLKHTELDLLIVGGGITGAGVAIQAAASGIKTGLIEMQDFAEGTSSR
STKLVHGGIRYLKSFDVGVVADTVKERAVVQGIAPHIPRPFPMLLPIYQESGSTFDMFSV
KIAMDLYDRLAGVEGSQYANYTVTKDEVLQREPQLSADNLQGGGVYLDFVNNDARLVIEN
IKEADELGGLMASHVKAVGVLHNDAGQVVGLHVKDLLDDTEFDIHAKLVINTTGPWADKF
NALDDHEKHAPTLRPTKGVHLVVDGSRLPVPQPTYMDTGLNDGRMFFVVPREGKTYFGTT
DTDYTGDYEHPRVEQEDVDYLLKVVNKRFPESHMTIDDIEASWAGLRPLINDNGSSDYNG
GGANSGKVSDDSFTALIEVVNAYEDDQATRADVERAISKLETAHAEAGLSPSQVSRGSSL
HQATDGLITLSGGKITDYRKMAAGALALIRRILVDRFNVDAPAVDSKKLQVSGGHFDPTN
VEETMAFYIRIGVDAGLSEKEAQDLANRFGSNTSRVLTYAVDGPAPGLSLKETMSLRYSL
NEEMTLTPVDYLLRRTNALLFHAETLAELKQPVVDEMAQTLGWDDSVKAQQLAALNAAIA
DSQLAYLKTAPAPVHPE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggtattttccaacgaaacgcgcaaacaaacgattcatcagttaaagcataccgagctc
gacttgctcatcgtcggtggcggcattaccggcgctggggtggcgattcaagcagctgcc
agcgggatcaaaaccggtttgattgagatgcaggactttgcggaaggcaccagttcgcgt
tcgaccaaattggtacacggcggtattcgctatcttaaatcttttgatgttggcgttgtc
gctgacactgttaaggaacgcgccgtcgtgcaagggatcgcgccgcatatcccgcggcca
ttcccaatgctgttgccaatttatcaagaatccggcagtacgtttgacatgttcagcgtc
aaaattgccatggatctctatgatcgattggctggtgttgaaggttctcagtacgccaat
tataccgtgacaaaagatgaagtccttcaacgtgaaccacaattgtccgctgataacctg
caaggcggtggcgtttatctcgatttcgtcaacaacgatgcacgccttgtgatcgaaaac
atcaaagaagctgacgaacttggcggcttgatggccagccatgttaaagcggtcggcgtg
ctgcacaatgacgctggtcaagtggttgggctgcatgttaaagacttgttggacgacact
gaattcgatatccatgccaaactggtcatcaacacaaccggtccatgggctgataagttc
aatgcacttgatgatcatgaaaaacacgcgccaactttgcggccaaccaaaggtgttcat
ctagtcgttgacggttctcgcttgccagttccgcaaccaacttacatggatactggctta
aacgatggtcggatgttcttcgtggttccgcgagaaggcaaaacgtattttggtaccact
gatacagattataccggcgattatgaacatccccgcgttgagcaagaagatgtcgattat
ctgctgaaagtcgtcaataaacgcttccccgaaagccatatgacgatcgacgatattgaa
gctagttgggctgggttgcgaccactgatcaacgacaacggcagttccgattataacggc
ggcggtgctaacagcggcaaagtttcagacgattcattcacggccttgatcgaggttgtg
aacgcttatgaagacgatcaagcaacccgcgccgatgttgaacgtgccatttccaaactg
gaaacagcacatgcagaagccggattaagcccatcccaagtttctcgcggcagttcgctt
caccaagcgacagacggactcatcaccctttccggtggtaaaattacagactatcggaaa
atggcggctggtgccctcgcgctgattcgccgtattctggtcgaccgtttcaacgttgac
gcgccagcagtcgattccaaaaagctgcaagtttccggcgggcattttgatccgaccaat
gttgaagaaaccatggccttctacattcggattggcgttgatgctggtttatcggaaaaa
gaagcccaagatctagctaaccggttcggttccaataccagccgagtgctcacttacgct
gtcgatggccctgcgccaggattaagtctgaaggaaaccatgagtctgcgttattcactc
aatgaagaaatgacgctcacaccggttgattatctcttgcgccgaaccaatgcccttctt
ttccacgctgaaacactggctgagttgaaacagccggttgttgacgaaatggcgcaaaca
ctgggatgggacgactcggtgaaagcccaacaactggccgccttgaatgctgccattgcc
gacagtcaactggcctatctaaaaacggcaccagcaccggttcatcctgaatag

DBGET integrated database retrieval system