KEGG   Lactobacillus paracasei ATCC 334: LSEI_1622Help
Entry
LSEI_1622         CDS       T00407                                 

Definition
(RefSeq) serine/threonine kinase protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lca  Lactobacillus paracasei ATCC 334
Brite
KEGG Orthology (KO) [BR:lca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lca01001]
    LSEI_1622
Enzymes [BR:lca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LSEI_1622
Protein kinases [BR:lca01001]
 Serine/threonine kinases: Other
  Bacterial family
   LSEI_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH RIO1 Kdo Kinase-like Haspin_kinase Seadorna_VP7 FTA2 PepSY_2
Motif
Other DBs
NCBI-GeneID: 4419022
NCBI-ProteinID: YP_806838
UniProt: Q038H6
LinkDB All DBs
Position
complement(1621035..1623035)
Genome map
AA seq 666 aa AA seqDB search
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AMATSEQVHPNIVSIYDVGESQGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHRDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVTIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLKTALSPARAHEAKYVVPKDDLDETRIMPVIPN
GPKPPHDEGGDADSPASQPSPKARPKKKSRRWWIIGIGILVAMLLMIGIGAVFANQKRDV
DVPDLRGMTTTQAKTALTSAGLKVGSYKYTYSTKVSKDLVIDSDPKRQVSVKEGSTVKLI
LSRGQPQFTLENYVGQDYTDVKSDLQKRGVTVKEKQVSANDEPSGKIVSQSIKAGKKVIA
DKTTITFGVSVAIKPNTFALRDLTGYTEKSLRDYANEVGLKIVISQAHSDTVDTGMVISQ
TPAAGTQVKPGDTVNVSVSQGPDPEETKTWSKTISIPYQAPASSSTASASNSSGSTSSSS
SAAPAPNGIQVFFADKTHNISTINRSFNITADDQITITLQVSTKYPGSYRIVRDGTVIAQ
EDNITQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattgagccggggacgattttaaatgagcgctacaagcttatcaaaacattaggcgaa
ggcggtatggccaacgtctatttggcacgcgacctgattcttgatcgcgatgtggcggtt
aaggttctccggcttgatttgcaaaatgaccccgatacagttcgccgctttcaacgagaa
gccatggcgaccagtgagcaggttcatccaaatattgtgtcgatttatgacgttggtgaa
agtcaaggtcagcaatttctggtcatggagtatgtcaaaggctctgatttaaagcactac
attgtcgagcatttccccattccatatcagcgcgtggtcgacatgatggaacagatcctt
tctgccgttcagacggcgcatgatcacaatatcattcaccgtgatttgaaaccgcagaat
attttgattgatccggatggcaatgctaagatcaccgattttgggattgcagtcgcgtta
tcggagaattcgatgacgatgaccaactcattattggggtcggtgcactatctatcaccg
gaacaggcgcgcggcagtatgccaacccgtcaaagtgatatttatgcgttaggcattatt
ctttttgaaatgctgactggttctgtacctttcgaaggtgattcggcagttacgattgcg
ttaaagcattttcaagaagaaattccgtcggtgcgcgcgtttgatccgcatatcccgcag
gcactggagaatgttgtttttaaggctacagccaaaaatccggctaatcgctataccagt
gcggatgccatggctagcgacctcaagacagcgctgagtccggcacgagcacatgaagca
aagtatgtggttcctaaagatgatctggatgagacacgaatcatgccagtcatccccaac
ggtcccaaaccgccgcatgacgaaggaggagatgctgacagtccagcgagtcagccaagt
ccgaaagcacgacctaagaaaaaaagtcgccgttggtggattattggcatcgggatactt
gtcgccatgctgctgatgattggtatcggcgcagtttttgccaatcagaaaagggatgtg
gacgtccccgatctacggggcatgaccacaacccaggcaaaaactgccttgaccagcgca
ggcttaaaagttgggtcatacaagtacacttattccacgaaagttagcaaggatttggtg
atcgattcagatccaaaacggcaggtgagtgttaaggaaggctcgacggtcaagctgatt
ttaagccgcggtcagccgcaatttacgctagagaattatgttgggcaagattacacagac
gtgaagtcagacttgcaaaaacgcggcgtaaccgtcaaagaaaaacaggtcagcgccaat
gacgaaccgtcaggcaagatcgtgtcacaaagcattaaagcaggcaaaaaggtcattgcg
gacaaaacgacgatcacatttggtgtttccgttgcaatcaagccaaatacttttgcgctt
cgtgatttgacgggttataccgaaaaaagtttgcgagattacgccaatgaagtcggactt
aagattgtgatttctcaagcgcactctgataccgtcgatacaggcatggtaatcagtcaa
acgccagctgctgggacacaggttaaaccaggcgacacagtcaatgtttcggtctctcaa
ggcccagatcctgaagagaccaaaacttggtcgaaaacaatttcaattccctatcaagca
ccggccagttcgagtaccgcaagtgccagcaatagcagtggcagcactagtagcagtagt
agtgctgcgcccgcacccaacggtattcaggtcttcttcgcagataagacacataacatt
agtaccattaatcggtcctttaacatcacggctgatgatcaaatcaccatcacgttgcaa
gttagcacgaaatacccaggcagctatcggattgtccgggacggtaccgtgattgcgcag
gaggataacattactcaatga

DBGET integrated database retrieval system