KEGG   Lactobacillus casei BL23: LCABL_04190Help
Entry
LCABL_04190       CDS       T00723                                 

Definition
(GenBank) Putative hexulose 6 phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00030  Pentose phosphate pathway
lcb00680  Methane metabolism
lcb01100  Metabolic pathways
lcb01120  Microbial metabolism in diverse environments
lcb01200  Carbon metabolism
lcb01230  Biosynthesis of amino acids
Module
lcb_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
lcb_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCABL_04190
  09102 Energy metabolism
   00680 Methane metabolism
    LCABL_04190
Enzymes [BR:lcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     LCABL_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim PEP_mutase QRPTase_C Peripla_BP_2 PdxJ PcrB
Motif
Other DBs
NCBI-ProteinID: CAQ65545
LinkDB All DBs
Position
419062..419733
Genome map
AA seq 223 aa AA seqDB search
MVLLTKTKYQVALDSFSLDDAVKFVRTIEDYIDIIEIGTPLVIDEGMHAVRRMIKEFPNK
EVLSDEKIMDGGYHEADLGYQAGAKYVTVLGVAEDKTIQGCLDAAHDADAILVVDTLKIP
NLAERAKEVEAMGVHFISVHTGFDQQQMGRTPLNDLRIVKANTNSIRVSVAGGINSKTID
QYLALEPDVVIMGGGLADADDPVDEARKIREAIEKHETEGSRQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggtacttttgaccaaaacaaaatatcaagttgcgctagattctttctcattagatgat
gcggtcaagtttgtacgaaccatcgaggactacattgatattatcgagattggaacaccc
ttagtcattgatgaggggatgcatgcggttcgtcggatgattaaagaatttccaaacaag
gaagttttatctgatgaaaagatcatggatggcggttatcacgaggctgatcttggctat
caagcaggcgccaagtatgtcactgtgttaggcgtggctgaagacaaaacgattcaagga
tgtttagatgcagcacacgatgcagatgccattttggttgtagatacgcttaagattcca
aacttggctgaacgtgctaaggaagttgaggcgatgggggttcattttatctctgtgcac
acaggttttgaccagcagcagatgggaagaacgccattaaatgatcttcgaatcgttaaa
gcaaatacaaactcaatccgggtctcagttgcaggaggcattaattccaagactattgac
caatatctagctttagagcctgacgttgtgattatgggaggcgggcttgctgacgctgac
gatccagtagacgaggctcgtaagattcgtgaggcaatcgaaaagcatgaaacggaggga
agcagacaatga

DBGET integrated database retrieval system