KEGG   Lactobacillus casei BL23: LCABL_10530Help
Entry
LCABL_10530       CDS       T00723                                 

Gene name
pstB1
Definition
(GenBank) Phosphate import ATP-binding protein pstB 1 (Phosphate-transporting ATPase 1) (ABC phosphate transporter 1)
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LCABL_10530 (pstB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcb02000]
    LCABL_10530 (pstB1)
Enzymes [BR:lcb01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     LCABL_10530 (pstB1)
Transporters [BR:lcb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    LCABL_10530 (pstB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_22 AAA_29 AAA_16 RsgA_GTPase AAA_23 Pox_A32 AAA_33 AAA_18 G-alpha AAA_28 AAA_30 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: CAQ66139
LinkDB All DBs
Position
1015236..1016054
Genome map
AA seq 272 aa AA seqDB search
MQELEKYSLDDTYIRPFDRDKQEIAIETENLRVFYGENEAIHKVSLPFERYKITALIGAS
GSGKSTYLRSLNRMNDNIEGARVTGKIMYRNLDINSDAVDVYEMRKHIGMVFQRPNPFAK
SIYDNIAFALRRFGLKDKQKLDEIVETSLKQAALWDQVKDDLNQSGMSLSGGQAQRLCIA
RAIAMKPDILLLDEPASALDPISTSAVEDTLMSLKDKYTIIIVTHNMQQAARISDYTAFF
YSGTAIEYDETRKIFTRPKIKATNDYVSGHFG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacttgaaaaatattcattagatgacacttatattcgtccattcgatcgcgac
aagcaggaaattgcgatcgaaacagagaatctacgcgttttttatggtgagaatgaagcc
attcataaggtctctttaccgtttgagcggtataagattacggcattaatcggcgccagc
ggttcagggaagtcgacttacttgcgctcgttgaatcgcatgaatgataatattgaaggt
gcacgtgtcaccggcaagatcatgtatcgcaaccttgatatcaatagtgacgcggtggat
gtctacgaaatgcgtaagcatattggtatggtctttcagcggcctaatccatttgccaaa
tctatttacgacaacattgcctttgccttacgtcgatttggattaaaagacaagcaaaaa
ctcgacgagatagttgaaaccagtttgaagcaggcggcgctttgggaccaagtcaaagat
gacttgaatcaaagtggcatgtcactttcaggggggcaggcgcagcgtttgtgtattgcc
cgcgcgattgcgatgaagcctgatattttgctgttagatgaaccagccagtgcgctggat
ccgatttcaacttcggcggttgaggataccttgatgtcattgaaggataagtatacgatt
atcatcgtcacacacaacatgcagcaggccgcccgaatcagtgattacacggcgttcttc
tacagcggaacggcgatcgaatatgatgaaacccgcaaaatctttacccggcctaagatc
aaagcgacgaacgactatgtctccggacatttcggctag

DBGET integrated database retrieval system