KEGG   Lactobacillus casei BL23: LCABL_12220Help
Entry
LCABL_12220       CDS       T00723                                 

Gene name
gatC
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C)
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00970  Aminoacyl-tRNA biosynthesis
lcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCABL_12220 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcb03029]
    LCABL_12220 (gatC)
Enzymes [BR:lcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LCABL_12220 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LCABL_12220 (gatC)
Mitochondrial biogenesis [BR:lcb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LCABL_12220 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: CAQ66307
LinkDB All DBs
Position
1176230..1176526
Genome map
AA seq 98 aa AA seqDB search
MISKDSVAHVAGLAKLQFSETELEKYTSQLSEILDMVEQLESVPTQDVPVTTQSIHLENV
MRADVAKPGEPVADLLKNVPTKKGTLIQVPAIIDKEED
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaagacagtgttgcgcatgtggcaggattggccaagttgcaattttctgaa
acggaactggagaaatacaccagccagctctccgagattctcgatatggttgaacaacta
gaaagtgttccgacgcaagatgtgccggtaactactcagagtattcatctggaaaatgtg
atgcgagcggatgtcgctaagccaggcgaaccggtagcggacttgttgaaaaatgtgcca
accaagaagggcactttgatccaagttccagcgatcatcgataaagaggaggactag

DBGET integrated database retrieval system