KEGG   Lactobacillus casei BL23: LCABL_12230Help
Entry
LCABL_12230       CDS       T00723                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00970  Aminoacyl-tRNA biosynthesis
lcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCABL_12230 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcb03029]
    LCABL_12230 (gatA)
Enzymes [BR:lcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LCABL_12230 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LCABL_12230 (gatA)
Mitochondrial biogenesis [BR:lcb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LCABL_12230 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAQ66308
UniProt: B3WD57
LinkDB All DBs
Position
1176530..1177984
Genome map
AA seq 484 aa AA seqDB search
MDYFKTSIDQLHEQLRSGKVTSSQLVDETLAGINQLDAEVDAFLALNADGAKEKAAAVDA
AGIADDQPLAGVPIAIKDNIVTKGVVTTAASKMLANFNPIYDATVMQKLDAAGAINVGKT
NMDEFAMGSSTENSAFKTTKNAWDHTRVPGGSSGGSAAAVAAGEVIAALGSDTGGSIRQP
AAFNGIVGVKPTYGRVSRWGLIAFSSSLDQIGTLTRHVKDAAQLLNVIAGHDERDSTTAD
TPVPDFTAKIGQDIKGMKIALPKEYLGKGVDPAVADKIKAAAKQFEDMGATVTEVSLPHT
QYAVPSYYIIASSEASSNLQRFDGIRYGFRAKDVKNIEDVYVRSRSEGFGPEVKRRIMLG
TFSLSAGFYDAYFKKAGQVRTLITRDFEDVFKDYDLIIGPTTPTVAFKIGEKVTDPVTMY
MNDILTIPVNLAGLPAASVPAGFVDGMPVGLQLIGKHFDESTIFQVAAAFEAQNDYLAQI
PGGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggattactttaaaaccagtatcgatcaattgcatgagcagttacgctccggcaaggtg
accagcagtcaattggttgacgagacattggccggcatcaaccagttggatgctgaagta
gatgccttcttagcgctgaatgctgatggcgccaaggaaaaggctgctgcagtagatgca
gccggtattgctgacgatcaaccactagccggtgtgccaattgctatcaaagacaacatt
gtcaccaaaggcgttgtcacgacggcagcgtccaagatgcttgccaacttcaatccgatt
tatgatgcgaccgttatgcaaaagcttgatgcagccggtgcgatcaatgttggtaaaacc
aacatggacgaattcgcaatgggctcgtcaacagaaaactccgcttttaaaacgactaaa
aatgcttgggatcacacgcgcgttcccggtgggtcgtcaggtggctccgcggcagctgtc
gcagctggtgaagtgattgccgcactgggcagtgatacaggcggttccattcgtcagcct
gctgcttttaacggcatcgtcggggtcaaaccgacatacggccgcgtttctcgctggggt
ttgattgcctttagttccagccttgatcagatcggaacgctgactcgacatgttaaagac
gctgcgcagttgctgaatgtgattgctggtcatgatgaacgtgatagcaccacagcggac
acacccgtaccggactttaccgccaaaatcggtcaggatatcaaggggatgaagatcgct
ttgccaaaggaatacttaggcaaaggggttgacccagcggttgcggacaagattaaagca
gctgccaagcagttcgaagacatgggcgcgacggtgacagaagtgtcactgccacatact
caatatgcggtgccatcttactacatcatcgccagctccgaagccagctccaatttgcag
cgctttgatggcattcgttatggtttccgcgccaaggatgtcaaaaatattgaggatgtt
tatgttcgttctcgatccgaaggttttggcccagaagtcaagcgacgtatcatgctgggc
accttcagtttgtcagccggcttttatgatgcatacttcaaaaaggcagggcaggttcga
actttgattacccgtgactttgaagatgtcttcaaagattatgatctgattattgggcct
acaaccccaaccgttgcgttcaaaattggcgaaaaagtcaccgatccagttaccatgtac
atgaacgacattttgacaattccggtcaatcttgccggcttaccggcggcatccgtgcca
gctggtttcgttgatggcatgccagtcggcttacagctgatcggcaaacattttgacgaa
agcacgatcttccaagttgctgcggcttttgaagcacaaaacgactacttagcacagatc
ccggggggcaagtaa

DBGET integrated database retrieval system