KEGG   Lactobacillus casei BL23: LCABL_18370Help
Entry
LCABL_18370       CDS       T00723                                 

Gene name
pkn1
Definition
(GenBank) Serine/threonine protein kinase (Putative)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lcb  Lactobacillus casei BL23
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcb01001]
    LCABL_18370 (pkn1)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LCABL_18370 (pkn1)
Protein kinases [BR:lcb01001]
 Serine/threonine kinases: Other
  Bacterial family
   LCABL_18370 (pkn1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr RIO1 APH Kdo Kinase-like Seadorna_VP7 PIP49_C Haspin_kinase FTA2 PepSY_2
Motif
Other DBs
NCBI-ProteinID: CAQ66917
LinkDB All DBs
Position
complement(1782840..1784840)
Genome map
AA seq 666 aa AA seqDB search
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AMATSELVHPNIVSIYDVGESQGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHCDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVTIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLKTALSPARAHEAKYVVPKDDLDETRIMPVIPN
GPKPPHDEGGDADSPASQPSPKARPKKKSRRWWIIGIGILVAMLLMIGIGAVFANQKRDV
DVPDLRGMTTTQAKTALTSAGLKVGSYKYTYSTKVSKDLVIDSDPKRQVSVKEGSTVKLI
LSRGQPQFTLENYVGQDYTDVKSDLQKRGVTVKEKQVSTNDEPLGKIVSQSIKAGKKVIA
DKTTITFGVSVAIKPNTFALRDLTGYTEKSLRDYANEVGLKIVISQAHSDTVDTGMVISQ
TPAAGTQVKPGDTVNVSVSQGPDPEETKTWSKTISIPYQAPASSSTASASNSSGSTSSSS
SAAPAPNGIQVFIADKTHNISTINRSFNITADDQITITLQVSTKYPGSYRIVRDGTVIAQ
EDNITQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattgagccggggacgattttaaatgagcgctacaagcttatcaaaacattaggcgaa
ggcggtatggccaacgtctatttggcacgcgacctgattcttgatcgcgatgtggcggtt
aaggttctccggcttgatttgcaaaatgaccccgatacagttcgccgctttcaacgagaa
gccatggcgaccagtgagctggttcatccaaatattgtgtcgatttatgacgttggtgaa
agtcaaggtcagcaatttctggtcatggagtatgtcaaaggctctgatttaaagcactac
attgtcgagcatttccccattccatatcagcgcgtggtcgacatgatggaacagatcctt
tctgccgttcagacggcgcatgatcacaatatcattcactgtgatttgaaaccgcagaat
attttgattgatccggatggcaatgctaagatcaccgattttgggattgcagtcgcgtta
tcggagaattcgatgacgatgaccaactcattattggggtcggtgcactatctatcacca
gaacaggcgcgcggcagtatgccaacccgtcaaagtgatatttatgcgttaggcattatt
ctttttgaaatgctgactggttctgtacctttcgaaggtgattcggcagttacgattgcg
ttaaagcattttcaagaagaaattccgtcggtgcgcgcgtttgatccgcatatcccgcag
gcactggagaatgttgtttttaaggctacagccaaaaatccggctaatcgctataccagt
gcggatgccatggctagcgacctcaagacagcgttgagtccggcacgagcacatgaagca
aagtatgtggttcctaaagatgatctggatgagacacgaatcatgccagtcatccccaac
ggtcccaaaccgccgcatgacgaaggaggagatgctgacagtccagcgagtcagccaagt
ccgaaagcacgacctaagaaaaaaagtcgccgttggtggattattggcatcgggatactt
gtcgccatgttgctgatgattggtatcggcgcagtttttgccaatcagaaaagggatgtg
gacgtccccgatctacggggcatgaccacaacccaggcaaaaactgccttgaccagcgca
ggcttaaaagttgggtcatacaagtacacttattccacgaaagttagcaaggatttagtg
atcgattcagatccgaaacggcaggtgagtgttaaggaaggatcaacggtcaagctgatt
ttaagccgcggtcagccgcaatttacgctagagaattatgttgggcaagattacacagac
gtgaagtcagacttgcaaaaacgcggcgtaaccgtcaaagaaaaacaggtcagcaccaat
gacgaaccgttaggcaagatcgtgtcacaaagcattaaagcaggcaaaaaggtcattgcg
gacaaaacgacgatcacatttggtgtttccgttgcaatcaagccaaatacttttgcgctt
cgtgatttgacgggttataccgaaaaaagtttgcgagattacgccaatgaagtcggactt
aagattgtgatttctcaagcgcactctgataccgtcgatacaggcatggtaatcagtcaa
acgccagctgctgggacacaggttaaaccaggcgacacagtcaatgtttcggtctctcaa
ggcccagatcctgaagagaccaaaacttggtcgaaaacaatttcaattccctatcaagca
ccggccagttcgagtaccgcaagtgccagcaatagcagtggcagcactagtagcagtagt
agtgctgcgcccgcacccaacggtattcaggtcttcatcgcagataagacacataacatt
agtaccattaatcggtcctttaacatcacggctgatgatcaaatcaccatcacgttgcaa
gttagcacgaaatacccaggcagctatcggattgtccgggacggtaccgtgattgcgcag
gaggataacattactcaatga

DBGET integrated database retrieval system