KEGG   Liberibacter crescens: B488_07480Help
Entry
B488_07480        CDS       T02395                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lcc  Liberibacter crescens
Pathway
lcc00020  Citrate cycle (TCA cycle)
lcc00190  Oxidative phosphorylation
lcc00650  Butanoate metabolism
lcc01100  Metabolic pathways
lcc01110  Biosynthesis of secondary metabolites
lcc01120  Microbial metabolism in diverse environments
lcc01130  Biosynthesis of antibiotics
lcc01200  Carbon metabolism
Module
lcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07480
   00650 Butanoate metabolism
    B488_07480
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B488_07480
Enzymes [BR:lcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B488_07480
    1.3.5.4  fumarate reductase (quinol)
     B488_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AGA64740
UniProt: L0EV61
LinkDB All DBs
Position
complement(834613..835392)
Genome map
AA seq 259 aa AA seqDB search
MVELSLPKNSRIKEGKTWNKPVNAKSLREYRIYRWSPDDQENPRIDTYYVDVDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACTKEMKDVKGSIKIYPLPHMS
VVKDLVIDMTHFYAQHRSIEPWLKTVSPAPANEWFQSHEDRQKLDGLYECIMCACCSTSC
PSYWWNGDRYLGPAILLQAYRWLIDSRDEAKGERLDNIEDPFRLYRCHTIMNCAQACPKG
LNPAKAIAEIKIMMLDRRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgagctttcactgccaaaaaattcccgtatcaaggaaggtaaaacgtggaataaa
cctgttaatgcaaagtcgttgcgtgaatatcgtatttatcgctggagtcctgatgatcag
gaaaatccaaggattgatacatattatgtcgatgtcgatgattgcggtcctatggttctt
gatggcttgctgtatatcaagaacaagattgatccgaccttgacgttgcgtcgttcctgt
cgtgagggcatttgtggttcctgtggcatgaatattgatggaacgaatactttggcatgc
accaaggaaatgaaagacgtaaaggggtctattaaaatttatcctcttccgcatatgtcg
gttgttaaagatcttgtgattgatatgacgcatttttatgcccaacatcgttcaattgag
ccctggcttaaaacggtatctcctgctcctgccaatgaatggttccagagtcatgaagat
cgacagaagcttgatggtctttatgaatgtattatgtgtgcctgttgttcaacttcttgt
ccaagttattggtggaatggcgatcgttatcttggtcctgccatattgctacaggcatat
cgttggttgattgattcgcgggacgaagccaagggagaacgtcttgataacattgaagac
cctttccgtctttatcgttgtcatactattatgaattgtgcccaggcttgtcctaaagga
ctcaatcctgccaaggcgattgctgaaataaagattatgatgctcgatcgtcgggtttaa

DBGET integrated database retrieval system