KEGG   Liberibacter crescens: B488_07490Help
Entry
B488_07490        CDS       T02395                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lcc  Liberibacter crescens
Pathway
lcc00020  Citrate cycle (TCA cycle)
lcc00190  Oxidative phosphorylation
lcc00650  Butanoate metabolism
lcc01100  Metabolic pathways
lcc01110  Biosynthesis of secondary metabolites
lcc01120  Microbial metabolism in diverse environments
lcc01130  Biosynthesis of antibiotics
lcc01200  Carbon metabolism
Module
lcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07490
   00650 Butanoate metabolism
    B488_07490
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B488_07490
Enzymes [BR:lcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B488_07490
    1.3.5.4  fumarate reductase (quinol)
     B488_07490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_oxidored FAD_binding_3 HI0933_like DUF4254
Motif
Other DBs
NCBI-ProteinID: AGA64741
UniProt: L0EWI4
LinkDB All DBs
Position
complement(835413..837266)
Genome map
AA seq 617 aa AA seqDB search
MSKKSLSASAVSQAQSYVYVDHAYDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRS
HTVAAQGGIAAPLANMTPDCWQWHLYDTVKGSDWLGDIDAIQYLTMEASKAVYELEHYGV
PFSRNEQGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHALLHTLYGQSLKHNAEFFIE
YFALDLIMSQDGRCTGVVAWCLENGEIHRFSAKIVVLATGGYGRAYFSATSAHTCTGDGG
GMIARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDL
ASRDVVSRCMMMEIREGRGVGKRKDHIYLYLNHLDPALLHERLPGISESARIFAGVDVTR
EPIPVLPTVHYNMGGIPTNYWGEVLNPDSTDPDCVSPGLMAVGEASCSSVHGANRLGSNS
LIDLVVFGRAAALRAAKIIDRSEAIPSLDIVACDRIVERFDRVRYANGETPTAILREKMQ
RAMQEDAGVFRSQESLAAGCRRLSVLWNEMSDIKVFDRSMIWNSDLMETLELQNLMANAI
VTVYSAEARKESRGSHAREDYKEGPFSGRDDVQWRKHSLCRVNCDTGEIHLEYRPVHIEP
ISAGIDLHRIAPKARVY
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaatctttatctgcctctgcagtatcacaagcacaatcttatgtttatgtt
gatcatgcttatgatgtcgtcgtcgtcggtgctggaggcgcaggcctgcgggcaacactt
ggtatggctgagcagggattaaaaacagcctgtattaccaaggtttttccaacacgttca
catacagtggcggctcagggagggattgctgctcctcttgccaatatgactcctgattgc
tggcagtggcatctttatgacacagtgaaaggctcggactggctgggggatatcgatgcc
attcagtatttgacgatggaagcgtcgaaggctgtctatgagcttgaacattacggtgta
ccgttttcccgtaatgagcaagggaaaatatatcaacggccttttggcggacatatgcaa
aattatggtgaaggacctccagtccaaaggacatgtgctgccgcagacaggacaggtcat
gctcttcttcatacgttatatggacaatccctgaagcataacgctgaattttttatcgaa
tattttgcacttgatcttattatgtctcaggatggccgttgtacaggggttgttgcctgg
tgtcttgaaaatggggaaattcaccgtttttctgcaaaaatagttgttctggcaacaggt
ggctatggtcgtgcctatttttcggcaacatcggctcatacctgtaccggtgatggtgga
ggtatgattgcacgtgcaggtttacctttgcaggatatggaatttgttcagtttcatcct
accggtatttacggtgccgggtgtcttattacagaaggggctcgtggagaaggcggatat
cttgtcaattctgagggagagcgttttatggaacgttatgctccttctgccaaggatctt
gcttctcgtgatgttgtttcccgttgcatgatgatggaaatcagagaagggcgtggagtc
ggcaaaagaaaagaccatatctacctgtatctcaatcatcttgatcctgctcttttgcat
gagcgattgcctggtatttcagagtcagcaagaatttttgctggtgttgatgtcacacgt
gaaccgattccggttttgccaacggttcattataacatgggtggcattcctaccaattat
tggggagaggttctgaatcctgacagtacggatcctgattgtgtttctccaggtcttatg
gctgttggcgaggcttcctgttcctcggtacatggtgccaatcgattgggttccaattcg
ttaatagacctggttgtttttggtcgtgcagcagcacttcgcgcagcaaaaatcattgat
cggtcagaggcaattccttctcttgatattgtcgcctgtgatcgtattgttgagcgcttt
gatcgtgttcgctatgcgaatggtgagacaccaacggctatattgcgtgaaaaaatgcag
cgtgccatgcaggaggacgctggcgtctttcggtcgcaggaatccctggctgccggttgt
aggcgtctttcagtcttgtggaatgaaatgtcggatatcaaggtttttgatcgttccatg
atctggaattcagatcttatggaaacccttgaattacaaaatttaatggccaatgccatt
gtaactgtctattcagcagaagccaggaaagagagcagaggttcccatgcacgtgaggat
tataaagaggggcctttttccggacgtgatgatgttcaatggcggaaacattctctttgc
agggtgaattgtgatacaggcgagatccatcttgaataccgtcctgttcatattgagcca
atttctgcgggtattgatcttcacaggattgctcctaaagcccgggtttattaa

DBGET integrated database retrieval system