KEGG   Legionella clemsonensis: clem_01355Help
Entry
clem_01355        CDS       T05016                                 

Gene name
katE
Definition
(GenBank) Catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00380  Tryptophan metabolism
lcd00630  Glyoxylate and dicarboxylate metabolism
lcd01110  Biosynthesis of secondary metabolites
lcd01130  Biosynthesis of antibiotics
lcd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    clem_01355 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    clem_01355 (katE)
Enzymes [BR:lcd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     clem_01355 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI Adeno_E3A
Motif
Other DBs
NCBI-ProteinID: ASQ44837
UniProt: A0A222NZ13
LinkDB All DBs
Position
complement(306667..308796)
Genome map
AA seq 709 aa AA seqDB search
MDKKREKKLHENSKKQQMEEFSSDHSGQFLTTNHGLRINHTDDSLKAGARGPTIMEDFHF
REKLTHFDHERIPERVVHARGSGAYGYFQVYESLEDLTMAKFLHDPQQKTPTFVRFSTVV
GFRGSADTVRDVRGFATKFYTEQGNYDLVGNNMPIFFIQDGIKFPDLVHSIKPEQDNQMP
QASAAHDTFWDFVANTPESAHMIMWVLSDRALPRSYRMMQGFGVHTFRFVNAKGHGRFVK
FHWRPLLGIHSLVWDETQKIAGKDPDFNRRDLWEAIEAGHFPEFEFGIQVIEEQDEFKLG
IDLLDATKIIPEELVPIRWVGKMTLNQNPENFFAETEQVAFHPGHVVPGIDFTNDPLLQG
RLFSYLDTQLIRLSGPNFHEIPINRPLVPVSNNQREGYHRMTVDKGKQSYFPNTVAKGCP
MTASRADGGYLHYAEKIAGNKVRERSESFKDFYTQASLFYNSMTDPEKKRIVSAFHFELG
KVMDKGIRKQVVELFNHVDGELAEQIAQGIGVAPPAFKKGKACDKIAKNLSQETSEHTAK
NSIATRKIAILVAEGYSATELKLVRKALVAEGAVCDIIAQFQGPLKSDSGDEVDVDKHYA
TTASVLYDAVFIPGGSRSIKVLAKQGDALNFINEAFKHCKPLGATGDGVDLLMLSSIKGV
TYSAGELQNDQGVVTIKQHTDLMPFIDQFKAAIAQHRHWQRNMKDEVPA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaaagggaaaaaaagcttcatgaaaacagcaaaaaacaacaaatggaggaa
ttttccagcgatcacagtggccaatttctaacaaccaatcatggactaagaatcaatcac
actgatgattcgttaaaagcaggagctcgaggccctactatcatggaggattttcacttt
cgtgagaaattaactcattttgatcatgaacgaataccagaaagagttgttcatgcgcgc
ggctctggtgcttatggctattttcaggtctatgaatctcttgaagatttaaccatggca
aaattccttcatgaccctcaacaaaaaacacccacctttgtgcgtttttccaccgttgtt
ggctttcgtggttctgctgatacagtcagagatgtgcgtggtttcgccacaaagttttat
actgagcaaggtaattatgatttagtcggcaataacatgccgattttctttattcaagat
ggtattaaattccctgatcttgttcactcaattaagccagagcaagataaccaaatgcca
caggcatccgcagcccatgacaccttttgggattttgtggctaataccccagaatcagca
catatgatcatgtgggttttatccgatcgtgcgttgccacgcagctatcggatgatgcaa
ggctttggtgttcacacatttcgctttgttaatgccaagggccacggacggtttgttaaa
tttcactggcgacctttgcttggtatccattctttagtttgggatgagacacaaaaaatt
gccggtaaagacccggatttcaataggcgcgacctctgggaagctattgaagctggccat
tttcctgaatttgaatttggcattcaggttattgaggagcaagatgaatttaagctcggt
attgatttgctggatgcaaccaaaattatcccggaagaacttgttcctatccgttgggtg
ggtaaaatgacgcttaatcagaacccagaaaatttttttgccgaaacagaacaagttgcc
tttcatccgggtcatgtggtgcctggcattgattttaccaatgatcctcttttacaaggc
cgcttattttcctatcttgatactcaattaattcgcctgagtgggcctaattttcatgaa
attcccattaatcgcccgcttgttcctgtaagtaataatcaacgtgaaggctatcatcgc
atgacagttgataaaggtaaacaaagctatttccccaatacagtggccaaaggttgccca
atgaccgcatcaagagctgacggaggttatcttcattatgctgaaaagatagccggcaac
aaagtgcgcgagcgtagtgaaagctttaaagacttttatacccaagcctcccttttctac
aacagcatgactgatccagaaaagaaacgtattgtgagtgcgtttcattttgaattggga
aaagtcatggataaaggcatcagaaaacaggtggttgaactgtttaatcatgtggatggt
gaattagctgaacaaatagctcaaggaataggggttgcaccgcctgcatttaaaaaaggc
aaagcctgcgacaaaatagccaaaaacctgagccaggaaacatctgaacataccgcaaaa
aacagtattgcgacacgtaaaatagctattcttgttgctgaaggttatagcgcaaccgaa
ttaaagctggtgagaaaagcactcgtagccgaaggtgcagtgtgtgatattattgctcaa
tttcaaggaccactcaaaagtgatagtggtgatgaagtggatgttgataaacattacgca
accactgcttccgtactatacgatgcagtatttattccaggtggcagtcgcagtataaaa
gtcctggctaaacagggcgatgcactcaattttattaatgaagcatttaagcattgtaaa
ccgttaggagccacgggggatggggtggacttactgatgttatcgtctattaaaggagtg
acctactctgcaggagaactccaaaatgatcagggcgtagtgactatcaaacagcacact
gatcttatgccctttattgatcaatttaaagcggctatagctcagcatcgccactggcag
cgaaatatgaaagacgaagtcccggcctga

DBGET integrated database retrieval system