KEGG   Legionella clemsonensis: clem_03980
Entry
clem_03980        CDS       T05016                                 

Gene name
recX
Definition
(GenBank) Regulatory protein RecX
  KO
K03565  regulatory protein
Organism
lcd  Legionella clemsonensis
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcd03400]
    clem_03980 (recX)
DNA repair and recombination proteins [BR:lcd03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    clem_03980 (recX)
SSDB
Motif
Pfam: RecX DUF494 Raf1_HTH tRNA-synt_2c
Other DBs
NCBI-ProteinID: ASQ45354
UniProt: A0A222P0H2
LinkDB
Position
913180..913632
AA seq 150 aa
MADAFECAVRLLARREHGACELAGKLAQKGFGQVEIDEAITKCQRLGLQSDRRFVEALSA
VRIRQGCGPLKILQELQAKHIARELIDEILSQEQDNWLDYAQAVWDKKFKKQPKLSYIEL
QKAQRFLLYRGFPTDIIAKVVKEIGIDVTR
NT seq 453 nt   +upstreamnt  +downstreamnt
atggctgacgcgtttgagtgtgcagtgcgtctgctagccagacgcgagcatggggcgtgt
gagctggctggaaagttagcgcaaaaaggttttgggcaggtagaaattgacgaagcaatc
actaagtgtcagcgtcttggccttcaaagtgataggcgctttgtagaagcgcttagcgct
gtacgcattcgtcaaggttgtgggcctttaaaaatccttcaagaattgcaggctaagcat
attgcccgtgaattaattgatgagattcttagccaggaacaagataattggttagattat
gcacaggctgtatgggataaaaaatttaaaaagcaacctaagctatcctatatagagcta
caaaaggcacaacgttttctgctatatcgcggatttccgacagatattattgcaaaagtt
gtgaaagagatcggaatcgatgttaccagatga

DBGET integrated database retrieval system