KEGG   Legionella clemsonensis: clem_07295Help
Entry
clem_07295        CDS       T05016                                 

Definition
(GenBank) Glycosyl hydrolases family 15
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00500  Starch and sucrose metabolism
lcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    clem_07295
Enzymes [BR:lcd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     clem_07295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: ASQ46012
UniProt: A0A222P2E4
LinkDB All DBs
Position
1659748..1661028
Genome map
AA seq 426 aa AA seqDB search
MKRILVLLSYVFIAVTHAAVFSPAEIATLKQNFIANITDTGAVIASPSRYYPDYYYDWVR
DAAITMDLIETWYEKDKKPEDKARLVNYVHWVEKAQHQTDTLPGQDILGEPKFYLDGRAY
DGPWGRPQNDGPALRALTLIRFAHSLIKNNELPYVQAHLYGGGLDPESMGAIKMDLEYIA
HHWQEKNYDLWEEVYGDHFFTVMVQRKALIEGAKLARELNEASTAAFYEEQARLMEERLN
QHIDQDRAIIQATLAPHPGPQKTNELDSAVMLGVLLGYTENNPFLPTNPYVRNTADALRE
QFKMLYPINDNYTDALLFGRYPGDTYDGYRNDGLGNPWFILTATMAEYYYKVAAMLPADR
KHQAFIKANVKQGDHYLRLIKQYAPDLTMSEQINLNTGIQQGANSLTWSYVAVLRAINLR
ESLNLH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattttagttttgttaagttatgtttttattgcagtaactcatgccgctgtt
ttctcacctgcagaaatagcaacactaaaacaaaattttattgccaatattactgataca
ggtgcagtcattgcttcaccttccagatattatcctgattactattatgactgggtacgt
gatgctgcaattactatggatttaattgaaacctggtatgaaaaagataaaaagcctgaa
gacaaagctcgactggttaattatgtacattgggtagaaaaggcacagcatcaaacagat
actctaccgggacaagatattttaggtgagcctaaattttatttagatggtcgtgcttat
gatggaccatgggggcggccgcaaaatgatggcccagcacttagagcattaacattaata
cgttttgctcattctctgataaaaaataatgaactgccgtatgtccaggctcatctttac
ggtggtgggctagatcctgaatccatgggagcgattaaaatggatttggaatatatagcg
catcactggcaagaaaaaaattatgacctatgggaagaagtttatggagatcacttcttt
actgtaatggtccagagaaaggcattaattgagggcgctaaactagcacgcgaactcaat
gaagcatcaacagccgccttttacgaagaacaagctcgtttaatggaagagcgattaaac
cagcatattgatcaagacagagccattatacaagctactctcgccccacatccgggtcct
caaaagacaaatgagctggattcagcagtgatgttaggtgtcttacttgggtatactgag
aataatccatttcttcctacgaatccctatgttagaaatactgcagatgctctaagagag
caatttaaaatgctttatcctattaatgataattacactgatgctttgttatttggacgc
tatccaggtgatacttatgatggctatcgtaatgatgggctagggaatccctggtttatt
ctaacagcaacaatggctgaatattattataaagtagctgcaatgcttcccgctgaccgg
aaacatcaagcattcattaaagccaatgtaaagcagggagaccattatttaagacttatt
aaacagtatgcccctgatttaaccatgagcgagcagattaatctcaatacaggcattcaa
caaggtgctaactccctgacttggagttatgtcgccgttcttcgagcaattaatttgcgg
gaatcattgaatttgcattaa

DBGET integrated database retrieval system