KEGG   Legionella clemsonensis: clem_08545
Entry
clem_08545        CDS       T05016                                 

Definition
(GenBank) hypothetical protein
Organism
lcd  Legionella clemsonensis
SSDB
Motif
Pfam: DUF4843
Other DBs
NCBI-ProteinID: ASQ46261
UniProt: A0A222P358
LinkDB
Position
1945633..1946064
AA seq 143 aa
MKINPKQETTSSTSIQQEAYDKRVDTLFLRFNAIYGALWLSAYNNEKALEAAKLEWADSI
KEFDSQVLTFAVEKIKRTQQRPPVIPVFVELCISIQKSIKAREEALRAKPENHKRTDPQI
VKSHIKEMMEKLTSPSVKEKKSC
NT seq 432 nt   +upstreamnt  +downstreamnt
ttgaagataaaccccaaacaggaaacaacgtcctccacttcaattcaacaagaagcgtat
gacaaacgggttgatactttgttcttaagatttaatgccatttatggtgccttatggctt
tctgcctataacaatgaaaaagcccttgaagctgccaagctggaatgggctgacagcatc
aaagaatttgatagccaggtcttaacctttgcggtggaaaaaataaaaagaacgcaacaa
cgccctcccgttattcctgtctttgtagaactttgcatcagcattcaaaaaagtattaag
gcaagagaagaagctctgcgggctaaacccgaaaaccataaaagaaccgacccacaaatc
gttaaatcccacatcaaagagatgatggaaaagctaaccagtccctcagttaaggagaaa
aaatcatgctga

DBGET integrated database retrieval system