KEGG   Legionella clemsonensis: clem_10160Help
Entry
clem_10160        CDS       T05016                                 

Gene name
ykoU
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
lcd  Legionella clemsonensis
Pathway
lcd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    clem_10160 (ykoU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcd03400]
    clem_10160 (ykoU)
Enzymes [BR:lcd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     clem_10160 (ykoU)
DNA repair and recombination proteins [BR:lcd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     clem_10160 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ASQ46581
UniProt: A0A222P420
LinkDB All DBs
Position
complement(2285190..2286989)
Genome map
AA seq 599 aa AA seqDB search
MVDKPPQGSQWLHEVKIDGYRIIAFKDGHSIRLMSRNHIDWTNKFKNVIKSLQTLPVERA
VFDGEVTLLDDKKQSNFQRLQNAMKGDKDYPFYYYIFDLLYYEKFNLKNLSLLQRKEILA
KVLATAPSTLRYSDHIISNGEEVFKKSCELGLEGIISKHAESTYLEKRSKSWVKVKCSQR
QEFIIGGYLPPQRSRQYFRSLFLGVFNEEGDLVYSGNVGTGFTQASLKEVYTELQKVVSE
KSPFNSIPPEAKKATWVKPTLVAEIEFSQWTSEGKLRHPSFKGLRKDKLASTVKREEMPM
KAIEKKSLSFRRKVIISNPEKILYKKDKITKQDLFDYYNEISDFILPYVMNRPLTLVRCP
ESYEDCFFQKHYYKSTPKALYAIPIKNKSDDDIDEYIYLKDKEGLLSLVQMGVLEIHPWG
SRIDKLECPDMITIDLDPGIDVSWKEIVKAAFEVKKHLDAFKLTSFVKTTGGKGLHVVVP
IRPEYNWEKVKNFSHVFVEFLEQLNPKAYVTNMAKEKRKGKIFVDYLRNQRGATAISAYS
TRARLHAPVATPIHWDELTDNFNDTFYTIHTLPLRLKKLKEDPWKEFWRIKQSLRLDKL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttggttgataaacctccacaaggttcgcaatggttgcatgaagtaaaaattgatggttat
cgaattattgcctttaaagatggtcattctattcgcctgatgtcacgaaatcatattgat
tggacaaataaatttaaaaatgtcattaagtctttgcaaaccttaccagtagaaagagcc
gtatttgatggcgaggtgactttattggatgacaaaaagcagtctaattttcaacgttta
caaaatgcaatgaaaggagataaagattatcccttctattactatatttttgacttgctt
tactacgaaaaatttaaccttaaaaacttgtccttattgcagcgaaaagaaatactcgca
aaagtactcgcaaccgctccttcaactttacggtatagcgatcacatcatcagtaatggc
gaagaggtttttaagaaatcttgtgaattaggtttagaaggtattatctctaaacatgcc
gaaagtacctaccttgaaaagcgctccaaatcatgggtaaaagtcaaatgcagtcaacgt
caggaatttattattggtggttatttgccccctcaacgttcccgacaatattttcgttct
ctttttcttggcgtttttaacgaagagggggacttagtttattcaggaaatgtgggcacg
ggttttacccaagcctcattaaaagaagtctataccgaattacagaaagtggtcagtgag
aaaagcccttttaattctattcctcctgaggcaaaaaaagcaacctgggttaagccaact
ttagtcgcagaaattgagtttagtcagtggacgtctgaagggaagttaagacatcccagc
tttaaaggtttaagaaaagataaactggcttctacagtaaaacgtgaggaaatgcctatg
aaggcaattgaaaaaaaatcactatccttcaggaggaaggtgattatctctaatcctgaa
aaaattttatacaaaaaagacaaaattaccaagcaggatctttttgattattataatgag
atcagtgattttatcttgccttatgtgatgaacaggccattaacactggtaagatgtcct
gaaagttatgaagactgcttttttcaaaagcactattacaaatccacgcccaaagcactt
tatgcaatccctattaaaaataaatctgacgatgacatcgacgaatacatttatttaaaa
gataaagaagggttattaagtttagtgcaaatgggagtacttgaaattcatccctggggg
agtcgtatcgataagttggaatgtcccgatatgattacgattgatttagacccaggtatc
gatgtgtcctggaaagagattgtgaaggcagcatttgaagtgaaaaaacatttggatgca
tttaaactaacttcttttgttaaaaccacaggtggcaaagggctacatgttgttgtgccc
atccggccggagtataattgggaaaaggtaaaaaatttttcccatgtgttcgttgagttc
ctggaacaactaaatccaaaagcctatgtgaccaatatggccaaagaaaaaaggaagggg
aaaatatttgttgattatttacgtaatcaacgcggtgctacagccattagtgcctattcc
acccgcgcgcgcttacatgctcctgtggccacccctattcactgggatgagctaaccgac
aactttaatgacaccttttatactattcataccttgcctttacgactgaaaaagctgaag
gaagacccctggaaggaattctggagaattaaacaatctttacgattggataagttataa

DBGET integrated database retrieval system