KEGG   Legionella clemsonensis: clem_12040Help
Entry
clem_12040        CDS       T05016                                 

Gene name
trmB
Definition
(GenBank) tRNA (guanine-N(7)-)-methyltransferase
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
lcd  Legionella clemsonensis
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcd03016]
    clem_12040 (trmB)
Enzymes [BR:lcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     clem_12040 (trmB)
Transfer RNA biogenesis [BR:lcd03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    clem_12040 (trmB)
 Prokaryotic type
    clem_12040 (trmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_25 DUF938 Methyltransf_31 MTS Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ASQ46944
UniProt: A0A222P509
LinkDB All DBs
Position
complement(2698304..2698972)
Genome map
AA seq 222 aa AA seqDB search
MRTIKSFVLRGGRISNRQQYALEHWLKDYELPVTNQPWDLVQIFGRDAETIVEIGFGMGA
SLLTMAEQYPERNFVGIEVHKAGIGSLTADIHEKGIKNIRLATHDAVEVFKHSLAKDSLA
GLQIFFPDPWPKKRHHKRRLIQPEFIKVVLERIKTGGFIHCATDWQEYAEHMLNVLSNEP
ALQNIQKDGGFSPRPETRPLTKFEQRGNKLGHNVWDLIYKKI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaattaaaagttttgtgctacgcggcggccgtattagtaacaggcaacaatat
gccttggaacattggttaaaggattatgaattaccagtcacaaatcagccttgggatttg
gtgcaaatctttgggcgagacgcagaaactatcgttgaaatagggtttggcatgggggcc
tctttattgactatggcagaacaataccctgaacgcaactttgtgggcatcgaagttcat
aaagcaggcatcggtagtttgactgcagatatacacgagaaaggtataaaaaatatacgt
cttgcgactcatgatgccgttgaagtatttaaacacagcctcgcaaaagactctttagcg
ggattgcaaattttctttccagacccgtggcctaagaagcgtcatcacaagcgccgtttg
attcagcctgaatttataaaagtagttcttgagcgaattaaaacaggtggttttatccat
tgtgcaacagattggcaagagtatgcagaacatatgctcaatgtgttgtcaaatgagcct
gccttgcagaatattcaaaaagacggcggtttctcgccacgacccgaaacacgtccttta
actaaatttgagcagcgtggaaacaagcttggtcataatgtttgggatttaatttataaa
aaaatttag

DBGET integrated database retrieval system