KEGG   Lactobacillus casei LC2W: LC2W_1383Help
Entry
LC2W_1383         CDS       T01956                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LC2W_1383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lce02000]
    LC2W_1383
Enzymes [BR:lce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LC2W_1383
Transporters [BR:lce02000]
 Other Transporters
  Pores ion channels [TC:1]
   LC2W_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_2 GST_C GST_N_3
Motif
Other DBs
NCBI-ProteinID: AEA53717
LinkDB All DBs
Position
1330201..1330830
Genome map
AA seq 209 aa AA seqDB search
MLKLFYASGTSAMAPHILLTDAGLNFELEKVNLDQKTWRGGDYDQINAKSYVPTLQIAPE
QYLTECAVILEYIDFQARQNDGSNYATDEYWQERVWLNYIATELHKNFISPFRKGNWLPN
TDDSKRLVWQRVAPRLAYVEARFQGPWLMGQHFSMTNPYLFVMTNWMHRLDFSFDHLPKL
KAFDERMRQRPSVQEVLRVEGKPHSVTDG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattattttatgcttcaggaaccagtgcaatggcgccgcatattctactgact
gacgcaggacttaattttgagttggaaaaggtgaacttagatcaaaaaacttggcgcggt
ggcgattacgatcaaatcaacgccaagtcttatgtgccgaccttgcaaatagcgccagaa
caatacttaacagaatgtgctgtgattttagagtacattgactttcaagcccgacaaaat
gatggtagcaattatgccacagatgaatactggcaggagcgggtgtggctcaactatatt
gccacagaactccacaaaaactttatttcgccttttcggaagggtaattggctacctaat
acggatgatagcaaacggttggtgtggcagcgagttgccccgcgactagcttatgttgaa
gcacggtttcagggaccatggctaatggggcagcatttttcaatgacgaatccttatctg
tttgtcatgacaaattggatgcaccggcttgatttttcatttgatcatttgccaaaatta
aaggcctttgacgagcgaatgcgacaacggccaagtgtgcaggaagttctgcgggtggaa
gggaagccgcacagcgttactgatggttaa

DBGET integrated database retrieval system