KEGG   Lates calcarifer (barramundi perch): 108874033Help
Entry
108874033         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00590  Arachidonic acid metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108874033
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108874033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 108874033
NCBI-ProteinID: XP_018517902
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MRSSVLGSVCALLLLLRESASLGDEVTSNTVNPCCYIPCQHWGVCVRYGEDKYECDCTRT
GYYGENCTVPEFWTRVRQFFKPGPDVVHYILTHFHWLWDIINRTFLRDILMRLVLTVRSN
LIPSPPTYNSKYGYLSWESYYNLSYYTRLLPPVPDDCPTPLGVKGKAGLPDPELLVERLL
KRRTFRPDPQGTNLMFAFFAQHFTHQFFKTYNRMGLGFTKALSHGVDAGHIYGDNLERQL
LLRLHKDGKLKYQLIDGEMYPPSVVDAPVKMSYPPGIPPERQMAIGQEVFGLLPGLGMYA
TLWLREHNRVCDILKAEHPTWDDEQLFQTTRLIVIGETIKIVIEEYVQHLSGYLLQLKFD
PTLLFNSQFQYGNRIALEFSQLYHWHPLMPDNFYINGDKVSYTQFLFNTSVLTHYGIEKL
VDAFSRQVAGQIGGGHNINAVVTKVAVGTIKESRQLRVQPFNEYRKRFNLKPYTSFRQFT
DNEEIASALEEFYGDIDSLEFYPGLMLERTREGSIFGESMVEMGAPFSLKGLLGNPICSP
DYWKPSTFGGKVGFDIVNSATLKRLVCLNTRTCPYVAFRVPKEEQSQTGKSDGKVRPDEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagatcctctgtcctaggatcagtttgcgctctccttttgctgttgcgggagtctgca
agcctgggtgatgaagttacctccaacacagtgaacccatgctgttatatcccctgtcag
cactggggtgtgtgtgtgaggtatggggaagacaagtatgagtgtgactgcactcgcacc
ggctactatggagaaaactgcactgtcccggagttttggacaagagtgcgtcagttcttc
aagcccggtccagatgtggtgcattacattctcacccatttccactggctctgggacata
atcaaccgcaccttcctacgggacattctcatgcgcctggttctaacagtcaggtccaac
ttaatacccagccctccaacttacaactcaaagtatggctacctcagctgggaatcctac
tataatctgagttactacactcggcttctgcccccggtgccagacgattgccctacacct
cttggggtcaaaggcaaggctgggctgcctgaccctgagctgctggttgagaggctgctg
aagagaaggacgttcagacccgacccccagggcaccaacctcatgttcgccttcttcgca
cagcacttcacccaccagttctttaagacctacaatcgcatgggcctgggcttcaccaag
gctctatcgcacggggtggatgcagggcacatttatggagacaacctggaacgtcaactc
ctgctcagacttcacaaagacggaaaactcaagtatcagttaattgacggcgagatgtac
cctccttctgtagtcgatgcacctgttaagatgagctaccctcctggaatcccccctgag
agacagatggctattggtcaggaagtgtttggactcctccctggtttgggaatgtacgct
acgctgtggctgagagagcataaccgagtctgtgacatcctgaaagcagagcatcccacc
tgggatgacgaacagcttttccagaccacacgcctcattgtcattggtgagactataaaa
atcgtgatagaggagtatgtgcagcacctcagtggatacctgctgcagctgaagtttgat
cccacgttgctgttcaactcccagttccagtatgggaaccgtattgctctggagttcagc
cagctctaccactggcaccccttgatgcctgacaacttctatattaacggagataaagtg
tcatacacacagttcctcttcaacacttctgttctcacacactacggcattgagaaactg
gtggatgctttctctcggcaagttgctggccagattggcggaggccataacatcaatgct
gtggtgaccaaagtggccgtgggaaccattaaggagtcccgccaactccgcgtgcagccc
ttcaacgagtacaggaagcgttttaacctgaagccatacacctcgttcagacaattcact
gataacgaggagatagccagtgcgcttgaggaattctacggtgacattgatagtcttgaa
ttttatcccggcttaatgttggagagaacacgagagggctccatatttggagagagcatg
gtggagatgggcgcccccttctctcttaaaggccttctgggaaaccctatatgctctcca
gattactggaagcccagcacctttggaggcaaagttggctttgacatagtgaactctgcc
acgctaaagagactggtctgcctgaacaccaggacgtgtccttatgtggcgttcagagta
ccaaaagaggagcaatcacagacagggaaaagtgacggtaaagtaaggcctgatgagcta
tga

DBGET integrated database retrieval system