KEGG   Lates calcarifer (barramundi perch): 108874096Help
Entry
108874096         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1-like
  KO
K02599  Notch 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    108874096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Ank Notch NOD DUF3454 NODP Ank_5 Ank_3 Ank_4 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 108874096
NCBI-ProteinID: XP_018518011
LinkDB All DBs
Position
Unknown
AA seq 2480 aa AA seqDB search
MYRFFVKLTFLIPAIVISQGLKCSLPTESCLNGGRCEATANGNGECKCPSDYVGSRCQYP
SPCSPSPCRNGGECRPISHGNTFDFRCVCRLGFTDRLCLTPTNHACMSSPCRNGGTCDLI
TLTAYRCRCPPGWSGKTCQLANPCASNPCANGGQCSAFDSTYICTCPPAFHGQTCKQDVN
ECAQTPSPCLNGGVCVNEVGSYHCRCPQEYTGQHCETPYMPCSPSPCQNGGTCVQKGDTT
YDCSCLPGFTGQHCEHNIDDCPGHNCQNGGVCVDGVNTYNCQCPPHYTGQYCTENVDECE
LMPNACQNGGTCHDTHGSYHCVCVNGWTGDDCSENIDDCASAACYHGATCHDRVASFFCE
CPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECSLGA
NPCEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHNDATCLDQIGGFHCICMP
GYEGVFCHINTDECASQPCLNNGKCIDKINSFHCECPKGFSGSLCQVDIDECASTPCKNG
AKCTDGPNKYTCECAEGYTGQHCEIDINECYSDPCHYGTCKDGLASFTCYCHPGYTGRLC
ETNINECLSQPCKNGGTCQDRENTYICSCPKGTAGFNCEVNLDDCKSKPCDYGRCIDKIN
GYECACEPGYTGAMCNINIDECVINPCHNGGTCIDGINSFTCLCPEGYNDATCLSQVDEC
GSNPCIHGRCQDLINGYKCTCDSGWSGPNCDINNNECESNPCMNGGTCKDMTSGYHCTCR
AGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCSPRPCKN
GGVCKESEDYQSFSCICPEGWQGQTCEIDINECVKSPCRNGAICHNTMGGYQCKCQPGYS
GQKCETDIDDCKPNPCSNGGLCHDGINSFTCTCLPGFRGGRCEQDINECESNPCRNGANC
TDCVNSYTCTCPPGFSGINCEINTNDCTDSSCFNGGTCMDGINAFTCLCLPGFTGSYCQY
DINECDSKPCLNGGTCLDSYGTYKCTCTHGYTGVNCQNLVRWCDSSPCKNGGSCWQQGAS
YTCQCQTGWTGLYCDIPSVSCEVAAKQQGVEVAHLCRNSGQCLDAGNTHYCRCQAGYTGS
YCQEQVDECSPNPCQNGATCTDYLGGYSCECVPGYHGVNCSKEINECQSQPCQNGGTCID
LINTYKCSCPRGTQGVHCEINLDDCTPSSDPLTNEPKCFNNGKCVDRIGGYQCVCPAGYV
GERCEGDVNECLSDPCDPRGSYNCIQLTNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGG
TCAVASNTPHGFICKCPPGFTGSSCEYDSRSCGSLNCRNGGTCVSGHLGPRCLCPPAFTG
PECQTPTDSLCISNPCYNGGTCQITPDAPFFQCSCPSNFNGLLCHILDYSFVGGFGRDIT
PPPEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWQNCSAALQCWRYF
NDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGLD
CANNMPEKLADGHLVLVVHIPPEQLKNRSSSFLRELSSVLHTNVVFRRDAKGEPMIFPYY
GNEQDLVKHNVLKRSADGWPEWASMPANMLGQVKERVSAMVSPRKRRELDPVQVKGSVVY
LEIDNRQCYQQSTECFQSATDVAAFLGALASSGNLNVPYIEAVTSVRPTPSSSELYPMYV
VFLGLAALGFICLGVLVSRKRRREHGQLWFPEGFKVSEPSKKKRREPLGEDSVGLKPMKN
SDINLMDDNQNEWGDEDPDCGRFRFEEQAMLDLSDHTDHRKWTQQHLDAADLRIPSIAPT
PPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGISEEEEDPSAEIISDFIYQGANL
HNQTDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGRTPLHAAVAADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMVEELINCHADANATDDSGKSALHWAAAVNN
VEAAVVLLKNGANKDMQDNKEETPLFLAAREGSYETAKVLLEHFANREITDHLDQLPRDI
AQERMHHDIVRLLDEYNVVRSPGLHNAPLSTSTLSPPLCSPSDYLSNLKPTLSSKKVRKI
SSGGKGGKDGGKDNRVKKKKSLDGKSNLLDTSAVLSPVESLESPHGYLSDVASPPMTSPF
QQSPPMSLNHLQGNGDSHIGQMSMGKDMGCMSFDPNPPRLSHLPVSSPSSQGTTSIGGSR
GGQCDWVSRMHPGVGQQGSFTQAPPISHSMMGPLHGVSTATLSQIMGYQNLQTSHLNSSA
HMMQQAHSRQLQHQNSNSTTAGQSLSQNFPSVELSSPDMQQNNSTGRSMPIHTVMPQETQ
ILGTQFLTPPSQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEG
ISSPPTSIHSQMNLIPDQFK
NT seq 7443 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtttctttgtgaaactaacatttctgattcctgcaatcgtcatctcacaaggt
ctaaaatgctccctacccactgaatcatgcctgaatggaggaagatgtgaagccaccgca
aatggaaatggagaatgcaagtgtcccagtgactacgtaggcagtcggtgccagtacccg
agcccctgcagcccctcaccctgccgcaacggtggcgaatgccgccccatctcccatggc
aacacatttgatttccgctgcgtgtgtcgcctgggtttcactgaccggctatgcctgacc
cccaccaaccacgcctgcatgagctccccctgtcgcaatggaggaacatgtgatctcatt
accctgactgcctaccgctgccgctgcccaccagggtggtcaggcaaaacatgccagctt
gccaacccatgtgcttccaatccatgtgcaaatggcggccagtgctctgccttcgattcc
acctacatctgcacctgcccgcccgctttccatggtcaaacctgcaagcaggacgtcaat
gagtgcgcccagaccccctccccctgcctcaacggcggcgtgtgtgtgaacgaggtggga
tcgtaccactgccgctgtcctcaagagtacaccggccagcactgcgagaccccctacatg
ccatgcagcccctcgccatgccagaatggaggcacctgcgtccagaagggagacaccacc
tacgactgcagctgcctgccaggcttcacaggtcagcactgcgagcataacatcgatgat
tgcccaggccacaactgccagaatggtggtgtgtgtgtagatggtgtgaacacctacaac
tgccagtgcccacctcattacacaggtcagtactgcacagaaaatgtggacgagtgcgag
ctgatgcccaacgcgtgccagaacggggggacgtgccacgacacgcatggcagctatcac
tgcgtctgcgtcaatgggtggacgggagacgactgcagcgagaacattgatgactgtgcc
agtgcagcttgttaccacggtgcgacctgccacgaccgcgtagcttccttcttctgcgag
tgtccccacggccgcacaggtttactgtgccatctcgatgacgcctgcatcagcaaccca
tgtcaaaagggctccaactgtgacaccaacccagtcaatggcaaggcaatctgcacatgt
cccccaggttacactggttcagcctgcaacctggacattgatgagtgctccctcggtgcc
aacccttgtgaacatggcggccgctgcctcaacaccaaaggctctttccagtgtaaatgt
cttcaaggatatgagggtcctcgttgcgagatggacgtcaacgaatgcatgtctaatcct
tgccataatgatgccacctgtctggatcagattggagggttccactgcatctgtatgcca
ggatatgagggagtgttttgccacatcaacactgatgagtgtgccagccagccttgtctc
aacaatggcaaatgcatcgacaagatcaactccttccactgcgagtgccccaaaggtttt
tcagggagtctgtgtcaggtggacattgatgagtgtgccagcaccccctgcaagaatgga
gctaaatgcacagatggtcccaacaagtacacctgcgaatgtgccgaaggttacacaggc
cagcactgtgagatcgacatcaacgaatgctactctgacccctgccactatggcacctgt
aaggatggcctggcatccttcacttgttactgccaccccggctacactggccgcctgtgt
gagaccaacatcaatgagtgtctgagccagccatgcaagaatggtggtacttgccaggac
agggagaacacatatatctgttcctgtcccaaaggcactgcaggtttcaactgtgaggtg
aacctggacgactgtaagagcaaaccctgcgactacgggagatgcatcgacaaaatcaac
ggctacgagtgtgcgtgtgagccgggctacacaggagcaatgtgtaacatcaacatcgat
gagtgtgtcatcaacccctgtcacaacgggggcacgtgcattgacggcatcaacagcttc
acctgcctgtgcccagaggggtacaatgacgctacctgtttgtcccaggtggacgagtgc
ggcagcaacccctgcatccacggccgatgccaggacctcatcaatggctacaaatgtacc
tgtgactccggatggagcgggccaaactgcgacatcaataacaacgagtgtgagtccaac
ccgtgcatgaacgggggaacctgcaaggacatgaccagcggataccactgcacatgcaga
gcgggcttcactggacctaactgccaaactaacatcaacgagtgtgcctccaacccctgc
ctcaaccagggcacctgcatcgatgatgtggctggatacaagtgcaactgtttgctgccc
tacactggtgaaaactgtgagaccctgctggctccctgcagtcctagaccctgtaaaaat
ggaggcgtatgtaaggagtccgaagactaccagagcttttcctgcatctgccctgaagga
tggcaaggtcaaacatgtgagatcgatatcaacgaatgtgtgaagagcccatgccgcaat
ggtgccatttgccataacactatgggtggctaccaatgcaagtgccagccgggttactct
ggtcagaagtgtgagacagacatcgacgactgcaaaccaaatccctgcagtaatggtggt
ctgtgccacgatggcatcaacagtttcacgtgcacctgcctgcctgggtttcgtggtggc
agatgtgagcaggacataaacgagtgtgagagcaacccctgcagaaacggagccaactgc
acggactgcgtcaacagctacacctgcacctgtccgcctggcttcagtggcatcaactgt
gagatcaacaccaatgactgcactgacagctcttgcttcaatggtggcacttgcatggat
ggaatcaatgcgttcacctgtctgtgtctccctggattcaccggcagctactgccagtat
gacatcaacgagtgtgactccaaaccatgcctcaatggaggaacttgtcttgacagttac
gggacgtacaagtgcacctgcacccacggctacacgggagtcaactgtcagaatcttgtg
cgctggtgtgactcctccccctgtaaaaatggaggttcgtgctggcagcagggagcctct
tatacctgccagtgccagactggatggacgggcctctactgtgacatccccagtgtgtcc
tgcgaggtagcagccaaacagcaaggtgtggaggtggctcacctgtgcaggaactcaggc
cagtgtctggatgctggaaacacacattactgccgctgccaggccggctacaccgggagt
tactgccaggagcaagtggatgagtgctcccccaatccttgccagaatggagccacctgt
actgattatctgggaggctacagttgtgagtgtgtccctggctaccacggtgtgaactgc
tccaaagaaatcaatgaatgtcagtctcagccctgccaaaatggaggaacctgcatcgac
ctcatcaatacatacaagtgctcctgtcccagaggaacacaaggtgttcactgcgagatt
aatctggatgactgcacgccctccagtgacccactgaccaacgagcccaagtgcttcaac
aacggcaagtgtgtggaccgcatcggaggctaccagtgtgtgtgcccggcggggtatgta
ggcgagcgctgtgagggtgatgtcaacgagtgtctgtcagacccctgtgaccccagaggg
tcctacaactgcattcagctcaccaacagctaccgatgcgaatgccgcactggatataca
ggtcagcgttgtgataaagtgtttgatggctgcaaaggaagaccctgcagaaatggaggg
acgtgtgctgttgccagtaacacacctcatggtttcatctgcaaatgtccacctggcttc
accggctcttcttgtgagtatgactctcgctcctgtgggagtctgaattgcaggaacgga
ggcacatgtgtgtcaggccacctaggcccgcgctgcctgtgtccaccggccttcaccggt
cccgagtgccagacccccaccgacagcctctgcatctccaacccctgctacaacggcgga
acgtgccagatcaccccagacgcgcctttcttccagtgcagctgcccaagcaatttcaat
ggtctgctgtgccacatcctggactactccttcgtcgggggtttcggtcgcgacatcacc
cctcctccggaagtggaggtgagctgcgagattcctcagtgtgacgagtgggcgggcaac
cacatctgcgattcgctgtgcaacaaccatgcctgcggttgggatggaggagactgctca
ctgaattttgatgatccgtggcaaaactgctctgccgccctgcagtgctggcgatacttc
aatgatgggaaatgtgatggccagtgcaacagtcccgggtgcctttatgatggctttgac
tgccaaggacaggaaggacaatgcaacccactgtatgaccaatactgcaaagaccactac
gctgatggtcactgtgaccagggctgcaacaacgcagaatgcgagtgggatggtctggac
tgtgccaataacatgccagagaagctggcagacgggcacttagttctggttgtccacatt
cccccagaacaacttaagaatcgttcttcgtccttcctcagagagctcagcagcgtcctc
cacaccaacgtggtgttccgtcgtgatgccaaaggggaaccaatgatcttcccttactac
ggcaacgaacaggacctggttaaacataatgtgctaaagcgctccgcagacggctggccc
gagtgggcttcgatgccggccaacatgttgggtcaggtgaaggagcgcgtgtctgccatg
gtcagcccacggaaacgcagagagctggatcctgtgcaagtcaaagggtctgtggtgtac
ttggagattgacaaccgtcagtgttaccagcagtccactgagtgtttccagagcgccaca
gatgtagctgcattcctcggagcactggcctccagtgggaatctcaatgttccctatatt
gaagctgtcacaagcgtgagacccactccctcatcttcagagctctaccccatgtatgtg
gtcttcctgggcttagctgctctgggcttcatctgcctgggcgtcctggtgtctcgtaag
cggcgacgagagcacgggcagctctggttcccggagggattcaaagtgtcggaacccagc
aaaaagaaacgcagagagccgctgggagaggattctgtcggactgaagcccatgaaaaac
tcggacatcaatctcatggatgacaatcaaaatgaatggggtgatgaggatccagactgc
gggcgcttcaggtttgaggagcaggctatgttggatttgagtgaccatactgaccatagg
aaatggacacagcagcacctggatgcagctgacctacgtattccatccattgctcctacg
cctcctcagggagagatagagaatgactgcatggatgtcaacgtcagaggaccagatggt
ttcactcccctgatgatcgcctcctgcagcggtggaggactggagactgggattagcgaa
gaggaagaagatccctcggcagagatcatctctgacttcatttaccagggcgccaacctc
cacaaccagaccgaccgcacgggcgaaactgccctccacctggccgcccggtacgcccgc
tccgacgctgccaagcgcctcctggagtccagtgccgacgccaacgttcaagacaacatg
ggccgcaccccgcttcacgctgctgtggctgcagatgcacagggagtgttccagattttg
atccgaaatcgtgccactgatcttgacgcccgcatgcatgatggaacaacaccgctgatc
ctggccgcccgactggcggtcgagggcatggtggaggaacttatcaactgccacgccgat
gctaacgccacagatgattctggtaaatctgctcttcactgggccgcggctgtaaacaat
gtagaggctgctgtggtgctgctgaaaaacggtgccaacaaagacatgcaagacaacaag
gaggagacaccactcttccttgcagcccgtgaaggcagctacgagacagccaaggttctt
ctggagcactttgccaatcgtgagatcaccgaccacctcgaccagctgcccagagacatc
gcccaggaacgcatgcaccacgacatcgtccgcctcctggatgagtacaacgtggttagg
agtcccgggcttcacaacgcccccctaagcacatccaccctctctcctcctctctgctcg
cccagtgactaccttagcaacctcaagcctaccctttcctccaagaaggttcgcaaaatt
agctctggggggaaaggagggaaggatgggggcaaagataatagagtgaagaagaagaag
tcgctggacgggaagagtaatttgctggacacgtcagctgtcctttccccagttgaatcc
cttgagtcaccgcacggctacctgtctgatgtggcctctcctcccatgacatcacccttc
cagcagtccccacctatgtctctaaatcacctacaaggcaatggagactcccatatcggc
cagatgagcatgggtaaggatatgggctgcatgtcctttgaccctaacccaccccgtctc
tctcacctgcctgtgtccagccccagcagtcagggcacaacatccataggtggaagcaga
ggaggccagtgtgactgggtctccaggatgcacccaggtgtaggtcagcaaggaagcttc
acgcaggcaccacccatatcccacagcatgatgggtcccctgcatggcgttagtaccgcc
accctgtctcagatcatgggctatcagaatctgcagaccagccacctcaactcgtccgcg
cacatgatgcagcaggctcactcgaggcagctccagcaccagaactccaactccaccaca
gccggccagtccctcagccaaaacttccccagcgtggagctgagcagccccgacatgcag
caaaacaacagcacgggccgctccatgcccatccacactgtgatgccgcaggagacgcaa
atcctcggcacccagtttctcactcctccctcccagcacagctattctgggcccatggac
aacacacccaaccaccagctacaggtccccgaccacccgtttctaactccctcccctggc
tcccccgaccagtggtccagctcatccccacattccaacatgtccgattggtcagagggc
atctccagcccgcctacaagcatccattcacagatgaatctgatcccagaccagtttaag
tag

DBGET integrated database retrieval system