KEGG   Lates calcarifer (barramundi perch): 108876301
Entry
108876301         CDS       T04895                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04060  Cytokine-cytokine receptor interaction
lcf04068  FoxO signaling pathway
lcf04144  Endocytosis
lcf04218  Cellular senescence
lcf04350  TGF-beta signaling pathway
lcf04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108876301
   04350 TGF-beta signaling pathway
    108876301
   04068 FoxO signaling pathway
    108876301
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108876301
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108876301
  09143 Cell growth and death
   04218 Cellular senescence
    108876301
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108876301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108876301
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108876301
Protein kinases [BR:lcf01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108876301
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH Reprolysin
Other DBs
NCBI-GeneID: 108876301
NCBI-ProteinID: XP_018521249
UniProt: A0A4W6EV11
LinkDB
Position
Unknown
AA seq 583 aa
MEDQRRSLSLRGALSVLFVTVLLEPGTAGMPPFYPMNQLCMFCDLELSSCSGTGTCMSNC
SITSICTESNEVCVAIWRKNETDFSIETLCHDPSKPLYGIMLDDYNSSTCVMKEKNTTSG
MAHFCSCTDEECNDVLLFSPIVDPTPDDPLVSVILVSLLPLLVMGIMVAGMFYWYRAYRQ
RMLNQEWESSIKKRKPRAGGLDCSDACAIMMDDDRSDSSSTHANNLNHNTEPLPIDLDLL
VGKGRFAQVYKAKLKQTTSDQFETVAVKIFPYEEYASWKNEKDIFSNTDLRHENILHFLT
AEERKVEKQYWLITAFHPRGNLQEYLTRHVISWEELQVLGSSLARGVAHLHSDRLPCGRP
KVPIVHRDLKSSNILVKNDLTCCLCDFGLGLCLDSSLSVDDLANSGQVGTARYMAPEVLE
ARLNLENIESFKQTDIYSMALVLWEMTSRCEAIGEVKDYEPAYGSKVREHPCVESMKDNV
LRDRGRPEIPDTWLRHQGVAVICATIKECWDHDPEARLTAHCVAERISEMEDELDKLSSR
SSSAEKIPEELKIPIEVEIPEKEVKITEIQDIIAVDCSVSDEK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggaggaccagcgtcgttctttatctttacgaggagctttatccgtcttgttcgtcact
gtgctgctggagcccgggactgccggtatgccccctttttaccctatgaatcagctttgt
atgttctgtgatctggagctgtcctcttgtagtggtacaggaacctgtatgtccaactgc
tccatcacatccatctgcacagagagcaacgaggtctgtgtcgctatctggaggaagaat
gagacagacttctccatcgaaactctctgccacgacccgtccaagcctctgtatggcatc
atgcttgatgactacaacagctccacctgtgtgatgaaggaaaagaacacaacaagtggg
atggctcacttctgctcctgtactgacgaggagtgtaatgacgtgctgttattctcccca
attgtggatcctactccagatgatccgttagtgtctgtgatactggtgagcctgctgccc
ttgctggtaatggggatcatggttgcgggaatgttctactggtaccgagcctaccggcaa
cggatgctcaaccaggaatgggagagcagcattaagaagcgaaagccaagagctggtggg
ctggactgcagcgacgcctgtgccatcatgatggatgatgacaggtcagacagcagctcg
acccatgccaacaacctgaaccacaacactgagccgctgcccatagatctggatctgctg
gtgggcaaaggtcgcttcgctcaggtatacaaggctaagctgaagcagaccacctcagat
cagttcgaaactgtggctgtgaagattttcccctatgaagagtatgcttcctggaagaat
gagaaggacattttctccaatacagacctccgacatgagaacatcctccacttcctgaca
gctgaggagaggaaggtggagaaacagtactggctcatcactgccttccaccccagagga
aacctacaggagtacctgacacgtcatgtgatcagctgggaggagctgcaggtgctgggc
agctctctggctcggggtgttgcccacctccacagtgaccgtctcccctgtggacgccct
aaggtgcccatagtccatcgagacctgaagagctccaacatcctggttaagaacgacctt
acatgctgcctgtgtgactttggcctgggactgtgtctggacagcagtctgtctgtggac
gacctcgccaacagtggacaggtgggtacagcgcgttacatggctccggaggtgctggag
gcccgactcaatctggagaacattgagtccttcaaacagactgatatttactccatggct
ctggtgctatgggagatgacatcgaggtgtgaagctattggagaggtgaaggactatgag
cctgcgtacggctctaaagtgcgagagcacccctgtgtggagagcatgaaggacaacgtg
ctgagagacagaggaagacctgagatccccgacacctggctcaggcatcagggcgtggct
gtgatctgtgccaccataaaggaatgctgggatcatgacccagaggcccgactcaccgct
cattgtgtcgccgaacgcatctccgagatggaggacgagctggacaaattatccagccgc
agctcctcagcagagaagatccctgaggagctgaagatcccaatagaggtggagatacca
gagaaagaggtgaaaatcacagaaatacaggacatcattgctgtggactgctccgtgagt
gatgagaagtga

DBGET integrated database retrieval system