KEGG   Lates calcarifer (barramundi perch): 108876626Help
Entry
108876626         CDS       T04895                                 

Gene name
ganc
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108876626 (ganc)
   00500 Starch and sucrose metabolism
    108876626 (ganc)
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108876626 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 108876626
NCBI-ProteinID: XP_018521784
LinkDB All DBs
Position
Unknown
AA seq 900 aa AA seqDB search
MAEENQPVSVIPDDEGQEKFKKSEHVAFYRRQMQGPNLQYRALLDTMVLTEKGARFELLE
PDTQTRLLLSVSPCKNDTVRILIDELQPIKSRYRVPDVITGEPQCEQLRVERQTKDSVTL
SWSSGRHQVRVWHFPFQVEILCEDEVMVTFNSKGKLWFEMLQDRARATSHDSELEEDAPG
LLWRETFRQFVDIKANGPSSTGADLCLHGFSHVYGLPEHADSLQLRDTRDGEPYRLYNLD
VFAYDLYSRFGLYGSVPLLVAHKVDRTLGVFWLNASETFVNIHYSPTDHEDEQTPPVKRR
RLQPQTDVHWLSESGVIDCVVLLGPSPQQLFSQYAQLTGYQALPPLFALGYHQCRWNYDD
EADVKAVDAGFDHHNIPYDVIWLDIEHTDGKRYFTWDPVHFPDPAGLQRHLEKKKRKLVV
ISDPHIKADPDWSLYCEARDGGHFVKDREGQLYHGSCWPGESCYLDFSSPATRAWYSRCF
TLEKYKGTTPSLFVWNDMNEPSVFDGPEQTMPKDAVHYGGWEHRELHNLYGFYQHMATVE
GLITRSGGSERPFVLSRSFFAGSQRLGAVWTGDNVASWGYLKISIPMLLSLSVAGIVFCG
ADVGGFIRDPDPELLVRWYQAAALQPFFRGHSANVTKRREPWLFGDKVTAAIRTVIQQRY
CLLPYWYTLFYQAHTSGLPPLRPLWVEFSQDQSTFTVDNQYMIGGALLACPVTEPGLQEV
KVSLPGSGEIWYDVHSAKVHKGGETLSLPVTLDTVPLFQRGGSVVCRSTVSGSCTAELQQ
LPLSITVALNPQGAADGELYLDDGHSFSYRDRKAFCLRRFSMLSGRLLCHAASEEGTFDC
DTVVHSVTFLGVKSKPSTVTVHVSGAKDTPAAFQYTQTYYKLTASNLNLRVAMDWEIQIV
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagagaatcagcctgttagtgtcatccctgatgatgaaggtcaagaaaagttc
aagaaaagtgaacatgttgctttttacaggcgacagatgcagggtccaaacctgcagtac
cgggccctgttggacaccatggtgctcacagagaaaggggcacgctttgaactgttggag
cctgacacacagaccaggctgcttctttctgtctcaccttgcaaaaatgacactgtaagg
atattgatagatgaactccagcccattaaatcacgctaccgagttccagatgtaataact
ggggaaccacagtgtgaacagttgagagtggagagacagactaaggactctgttaccctt
tcttggtcttcaggacgtcatcaggttcgcgtttggcattttcctttccaagtggagatc
ctgtgtgaagatgaagtgatggtcacatttaattctaaaggcaaactgtggtttgagatg
ctgcaggatcgagccagggccacatctcatgacagtgagcttgaagaggacgccccgggt
ttattatggagagagactttcaggcagtttgtggatatcaaagctaatggtcccagcagc
actggggcagacctctgtcttcatggtttcagtcatgtatacggcctgccagaacatgct
gacagcctgcagctcagagacaccagagacggtgaaccttatcggctgtataacttggac
gtctttgcctatgacttgtacagtcgtttcggcctgtacgggtctgtgccactgttggtg
gcccacaaagtcgacaggactttgggtgtgttttggctcaatgcatctgagacttttgtg
aacatacattacagtcccactgaccatgaggatgagcaaacacccccagtgaagaggagg
cggctgcagccgcagactgacgtccactggctgtcagagagtggtgtgattgactgcgtg
gttctccttgggcccagtccacagcagctcttcagccagtatgctcagctgacaggatat
caagccctgccccctctatttgccctcgggtaccaccagtgccgctggaactacgatgat
gaagctgatgtgaaggctgtggatgctggatttgatcaccacaacatcccttatgatgtt
atctggctggacattgagcacacagatgggaagcgttatttcacctgggaccctgttcat
tttccagatccagccggtctgcagcgccacctagagaagaagaaaaggaagctggttgtt
ataagtgatccccacatcaaagctgatcctgattggtccctgtactgtgaggccagagat
ggtggacattttgtcaaagacagagagggacagctctatcacggctcatgctggcctggt
gaatcctgttaccttgattttagcagcccagccactagagcatggtactccagatgcttc
accctggaaaagtacaaaggaacaacaccatcgttatttgtgtggaacgatatgaacgaa
ccgtctgtgtttgacgggccggagcagacgatgccgaaggatgcagtgcattatggcggc
tgggaacaccgggaattgcacaacctgtacggcttttatcagcacatggccacagtggag
ggtctgataactcggtcaggtggctcggagaggccttttgtcctgtcacgctccttcttt
gctgggtcacagagacttggagcagtatggacaggagacaacgttgccagttggggatat
ctgaagatctcaattccaatgcttttgtctcttagtgtggcaggcatagtattttgtgga
gctgatgttggtggctttattcgggatccggatccagagttgctggttcgctggtaccag
gcagccgccctgcagccgtttttccgcggtcactctgcaaatgtgacaaaacgtcgggaa
ccctggctgtttggagacaaggttaccgctgcaatccgcactgtaatccaacaacggtat
tgcctgctgccctactggtacactctgttctaccaggctcacacctctggtctgcctcca
ctcagacctctgtgggtggagttctcacaagatcagagcaccttcactgtggacaaccaa
tatatgattggaggagcactactggcctgtcctgtcaccgaaccaggtcttcaagaggtc
aaagtgtcacttcctggatctggtgagatttggtatgatgtccactctgcaaaggtgcac
aaaggaggcgagactctgagtcttccagtcaccctggacacagtacctttgttccagcgt
ggtggctcagtggtctgcaggtcaacagtaagtggctcctgtacggccgaactccagcag
ctgcctctctccatcactgtggctctaaaccctcagggtgcagctgatggtgagttatac
ctggacgacggccactccttcagctaccgtgacagaaaggccttctgtctgcgcaggttc
agcatgctgtcaggccggctgctctgccatgctgccagtgaagaaggaacatttgactgt
gacactgtcgtacactcggtcaccttcctgggggtgaagagcaaaccgtccactgtgact
gtgcatgtgtcaggtgctaaagacactcctgctgcatttcagtacacacagacctactac
aaactgacagcgagcaacctgaacctcagagtggcgatggactgggagatacagatagtt
taa

DBGET integrated database retrieval system