KEGG   Lates calcarifer (barramundi perch): 108876951Help
Entry
108876951         CDS       T04895                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00051  Fructose and mannose metabolism
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf00520  Amino sugar and nucleotide sugar metabolism
lcf00524  Neomycin, kanamycin and gentamicin biosynthesis
lcf01100  Metabolic pathways
lcf01200  Carbon metabolism
lcf04910  Insulin signaling pathway
Module
lcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108876951
   00051 Fructose and mannose metabolism
    108876951
   00052 Galactose metabolism
    108876951
   00500 Starch and sucrose metabolism
    108876951
   00520 Amino sugar and nucleotide sugar metabolism
    108876951
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108876951
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108876951
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108876951
Membrane trafficking [BR:lcf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108876951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108876951
NCBI-ProteinID: XP_018522316
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMHRFRRELAKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVRVSHEKKQTVQMESQIYDTPEDIIH
GSGTRLFDHVAECLGDFMEKHSIKDKKLPVGFTFSFPCQQTKLDEGYLITWTKRFKASGV
EGMDVVKLLNKAIKKRGDYNADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLSKAKEILTRLG
VEPSADDCIAVQHVCTIVSFRSANLIAATLAGILTRLKENKGVSRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLADQSRQIAETLSEFRLT
TEQLLEVKKRMKTEIQNGLSKSTQDCATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMIEGDEGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSHRAAQLCGAGMAA
VVDKIRENRGLDHLNITVGVDGTLYKLHPHFSRIMHQTVNELAPQCNVNFLLSEDGSGKG
AALITAVGCRLRQELNSK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccaactactagcctattacttcactgaactcaaggatgaccaggttaaa
aagatcgataagtacctgtactccatgcgtttctctgatgagacgttactggacatcatg
catcgctttcggagggagctggccaaaggactgggtcgggacactaaccccaccgccgca
ctaaagatgctgccaacgtttgtgcggtcaatccctgatggctcagagaaaggagacttc
attgcattggatctgggaggcagtaacttcaggatcctgcgtgtcagagtcagccatgag
aagaaacagactgttcagatggagagtcagatctatgacacaccagaggacataattcac
ggcagtggaacaagactgttcgaccatgtggcagaatgtcttggtgacttcatggaaaaa
cacagcatcaaagacaagaagctgccagtgggttttaccttctccttcccctgccagcag
actaaactggacgagggatatttgataacatggacaaagcgtttcaaggctagtggagtg
gaggggatggatgttgtcaagctgctcaacaaagctattaagaaacgaggagactataat
gctgacatcatggctgtagtaaatgatacggttggaacgatgatgacctgtgggtttgac
gaccaacgctgtgaagtcggcatcatcattggtacaggcaccaatgcgtgctacatggag
gagctgcgtcacattgacctggtggagggagatgagggccgaatgtgtgtaaacactgag
tggggagccttcggggacgatggcaggctggaagacatcaggacagagttcgacagagag
atagaccgaggctctctcaaccctggcaaacagctatttgagaagatggtcagtggtatg
tacatgggggagttggttcgtctcattcttgtgaaaatggccagagaaggcctgctgttt
gagggaaggatcacccccgagctgcttactaaagggaagtttgagactaagcacgtctca
gccatagagaagagtaaggaaggattgtccaaagccaaagagattctgaccagacttggc
gtggagccttcagctgatgactgtatcgctgtgcagcatgtttgcaccattgtgtctttc
cgctctgccaacctgatagctgccacgctggctggcatcctgacaaggctaaaagagaac
aaaggtgtgtcacgacttcggaccactgtaggcatcgatggatctctctacaagatgcat
ccacagtatgcccgtcgtcttcataagacagtccgtcgtctggtcccggactctgatgtc
cgattcctcctatcagagagtggcagtggaaagggtgctgccatggtgacagctgtggcc
tacagactcgccgaccaatcacgacaaatcgccgaaacattgtccgaattccgcctgaca
accgaacagctgctggaggtaaagaagcgaatgaagacagagatccaaaatggcctttca
aagagcactcaggactgtgctactgtcaaaatgctaccaacctttgtacgaagcactccg
gatggcacagaaaatggtgatttcctggctttggatttaggtggaaccaacttcagagtt
ctgttggtcaagattcgctctggcaagaggagaacagtggagatgcacaacaagatctac
gctattcctctagaagtcatgcagggcacaggagaggagctgtttgatcacattgtgcag
tgcatcagtgacttcctggactacatggggatgaagaacgctcgtcttcctctgggcttc
accttctcgttcccctgccggcagaccagcctggacgctggcatcctggtgacatggacc
aaaggcttcaaggcgacagactgtgaaggagaagatgtggtgggactgttgagggaggca
attaagaggagagaggagtttgacctggatgtagtggctgtagtcaacgatacagtggga
accatgatgacttgtgcctatgaggaacccacctgtgagatcggactcattgctggcact
ggcagtaatgcgtgctacatggaggagatgaggaacatcgagatgattgagggagatgag
ggacggatgtgtgtcaacatggaatggggggctttcggagacaacggatgccttgatgat
attaggacggaatatgaccgcgctgtggatgacttctcactcaatccaggcaaacaaaga
tatgagaaaatgtgcagcggcatgtaccttggtgaaattgtgcgaaacatcctcatagac
atgacaaagagaggattcctgtttagaggacagatttctgagacactgaagaccagaggc
atctttgaaacaaagttcctctcacagatagagagtgacagattggctttgctgcaagtc
agatccatcctacaacacttaggactggacagcacctgtgatgacagtatcattgtcaaa
gaggtatgtggaacagtgtcacatcgtgcagctcagctgtgtggggcaggaatggcggcc
gtggtcgataagatcagagagaaccgaggactggaccatctcaacatcactgtaggggtt
gatggaacgctctacaaacttcatccacatttctcccggatcatgcaccagacagttaat
gaactggctcctcagtgtaatgtcaacttcttgctgtcagaggacggcagtgggaaagga
gctgcactcatcacagccgtgggctgccgactgagacaagagctgaacagtaaatag

DBGET integrated database retrieval system