KEGG   Lates calcarifer (barramundi perch): 108877824
Entry
108877824         CDS       T04895                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
lcf04115  p53 signaling pathway
lcf04218  Cellular senescence
lcf04310  Wnt signaling pathway
lcf04340  Hedgehog signaling pathway
lcf04371  Apelin signaling pathway
lcf04510  Focal adhesion
lcf04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108877824 (ccnd1)
   04340 Hedgehog signaling pathway
    108877824 (ccnd1)
   04371 Apelin signaling pathway
    108877824 (ccnd1)
   04068 FoxO signaling pathway
    108877824 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108877824 (ccnd1)
   04115 p53 signaling pathway
    108877824 (ccnd1)
   04218 Cellular senescence
    108877824 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108877824 (ccnd1)
   04530 Tight junction
    108877824 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108877824
NCBI-ProteinID: XP_018523542
UniProt: A0A4W6BQI2
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSCQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTETKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatcaggagagcctaccaagacgtc
aacctgctcaacgaccgagttctccacacaatgctgaaagcagaggaaaactacctaccg
tctccaaactacttcaaatgtgttcagaaagaaattgtacctaaaatgaggaaaatagtc
gccacctggatgttagaggtctgcgaggaacagaaatgtgaggaggaggtttttccgttg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaacacgactacag
ctgctgggagctacatgcatgtttctagcatcgaagatgaaggagactgtgcccttaaca
gcggagaaactctgtatctacacggacaactcggtccagcccggagagctgctgcaaatg
gagctgctggttctcaacaagttgaagtgggatctggcttcagtcacacctcacgacttc
atcgagcacttcctgtccaagctgaagatctacccgtccaccaagcagatcctcaggaaa
cacgcccagacttttgtggcactctgtgccacagatgttaatttcatcgccagtcctccg
tccatggtggcagccgggagtgtggttgcagctgttcaaggtctctacctgaagagccaa
gatgcctccttgtcctgccagaacctcaccaacttcctgtcacaggttatacgcagtgac
ccggactgcttgcggtcatgtcaggagcagatagagtcactgctagagtctagcctgcgg
caggctcagcagcacagcagcacaacagaaaccaaacgcgtagacgaggatgtggacttg
tcttgtacaccgacagacgtcagagacatcaacatctga

DBGET integrated database retrieval system