KEGG   Lates calcarifer (barramundi perch): 108877843Help
Entry
108877843         CDS       T04895                                 

Definition
(RefSeq) ammonium transporter Rh type C 2
  KO
K06580  ammonium transporter Rh
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcf02000]
    108877843
   04090 CD molecules [BR:lcf04090]
    108877843
Transporters [BR:lcf02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   108877843
CD molecules [BR:lcf04090]
 Proteins
  108877843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp Glyco_hydro_71
Motif
Other DBs
NCBI-GeneID: 108877843
NCBI-ProteinID: XP_018523571
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MGNCCERAGNFFGPQKNTNVRVSLPAVCFVWQIAMIVLFGVFIRYDEESDAHWVVYKKDH
NVTDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGLQWALLMQ
GWFHSLDHTTGKIYIGVESLINADFCCAGSLIAYGALLGKVSPVQLMVVTLFGVTLFAVE
EYIILDLLHCRDAGGSMVIHAFGGYYGLAISWVLYRPNLNQSKRLNGSVYHSDMFAMIGT
LFLWMFWPSFNSAITDHGDGQHRAAINTYIALASSVLTTVAISSMSQKGGKLDMVHIQNA
TLAGGVAMGTAAEFMITPYGSLIVGFCCGIISTFGYLFITPFLEKYLKLQDTCGVHNLHA
VPGMLGGFIGAIVAAAADESVYSKEGLINVFDFEGDFANRSPGTQGGFQAAGTCVSIAFG
LVGGAIVGFILKFPIWGDPADDNCFDDEVYWEVPEDEETIPPVLEYNNHMIHKHQEISES
NFSVEQS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgctgcgagagggcagggaatttttttggcccccagaagaacaccaacgtg
cgtgttagtctgccggccgtctgcttcgtctggcagattgctatgattgtgctgtttgga
gttttcattcggtatgatgaggagtcagacgcacactgggtggtgtacaaaaaggaccac
aacgtcaccgacattgaaaatgacttctacttcagatatcccagcttccaggacgtccac
gtcatgatcttcgttggctttggcttcctcatgaccttcctgaaacgctacagctttggc
ggtgtgggcttcaacttcctgatcgctgcctttggtctgcagtgggctctcctcatgcaa
ggctggttccactctctcgaccacaccaccggaaaaatctacattggagttgagagtctg
atcaacgcagacttctgctgtgccggctctctgatcgcctacggtgccctcctggggaaa
gtgagccccgtccagctgatggttgtcaccttgtttggcgtcacgctgtttgctgtggag
gaatacatcatcctcgacctccttcattgcagagatgctggcggctccatggtcattcac
gccttcggagggtactatggtctggccatctcctgggtcctctaccgaccaaacctaaac
caaagtaaacgactcaatggatctgtctaccactctgatatgttcgccatgattggtaca
ctgttcctgtggatgttctggcccagtttcaactcagccatcacagaccacggtgacgga
cagcacagagcagccattaacacttacatcgccctggcctcctccgtgctcaccactgtg
gccatctccagcatgtctcagaagggaggaaaactagacatggtgcatatccaaaatgcc
actctggctggtggcgttgccatgggaacggcagcagagttcatgatcactccttatggg
tcactcattgtgggtttctgctgtggaatcatctccacctttggctacctgtttatcacg
cctttcttagagaaatacctcaagctccaggatacatgtggtgtccacaacctgcatgct
gtgccagggatgcttggtggcttcataggtgccatcgttgctgcagcagctgatgaatct
gtctatagtaaagaagggttgatcaacgtgtttgactttgaaggagactttgcaaacaga
tctccaggaacacagggaggcttccaggctgctggcacatgtgtttccatcgcatttgga
cttgttggaggcgcaattgttggtttcatcctgaagttcccgatctggggcgaccctgct
gatgacaactgcttcgatgatgaagtttactgggaggttcctgaggatgaggagaccatc
cctcctgttttggagtacaacaaccacatgatacacaagcaccaagaaatatctgagtca
aacttctctgtggagcaaagttag

DBGET integrated database retrieval system