KEGG   Lates calcarifer (barramundi perch): 108878605Help
Entry
108878605         CDS       T04895                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00512  Mucin type O-glycan biosynthesis
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108878605 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108878605 (galnt9)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108878605 (galnt9)
Glycosyltransferases [BR:lcf01003]
 O-Glycan biosynthesis
  Mucin-type
   108878605 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 108878605
NCBI-ProteinID: XP_018524988
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELIQLGRISDQRLRARNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSHDAEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTGWAEPILTRMKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKRLQCQSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CDAVSRISQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPKH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaatcaaaactttgctgaccgtcaacattttagtgtttgtgggg
attatcctgttctcggtgtactgcaggatccaggaccgatccgaggagctcatccagcta
gggcgtatttctgaccagaggctgcgagccaggaatggcaaagtttccaacttggtggac
aggcagtctattctccagaggctggagaggctggaggatgtggtctacaatcaactaaac
ggtttggcgaagcccatggggctggtggagggacccggaggccttggccaagggggagct
gctgctactctgggagaggacagccacgatgctgagggaaagtatgaggaatacggctac
aatgctcagctcagtgaccgcatctccctggacaggagcatcccagactacaggcctaaa
aagtgtaaacagttgacatacccagaggatcttccacagatctctgtagtcttcatcttc
gtgaacgaggcactgtcggtgatcctgcgatccgtccatagtgtggtcaaccacacacca
gcccacctgctgaaggagataatcctggtggacgacaacagtgatagtgtggagctgaaa
ttcaacttggaccagtatgtgaacaaacgctacccaggcctggtaaagattgtgaggaac
agcaagcgggaaggtctgatccgagccagaatacacggctggaatgcagccacggctcct
gtcgttggcttctttgatgcccatgtcgagttcaacactggctgggctgaacctattctg
actcgaatgaaggaggaccacacccgcatcatcctgcctgccatagacaacataaagtac
aacacatttgaggtgcagcagtacgccaatgctgcccatggctacaactgggggctgtgg
tgtatgtacatcatcccgccgcaggagtggctggacaagggcgatgaaacagcccctatc
agaactccagctatgatcggctgctcatttgtggtagatcgggaatactttggtgaaatt
ggtctgctggatcctggcatggaggtctacggaggcgagaacattgagctgggcatgcgg
gtgtggcaatgtggagggagtatggaagtcctgccatgtgccagagtggcccacatcgag
cgtaccaagaagccctacaacaatgacatagattactacgctaagcgcaatgccctgcgg
gctgctgaggtgtggatggatgaatacaaatcccacgtctacatggcctggaatattccc
atgaataacccgggggttgattttggggatgtctcggagcgcttggccttaaggaagagg
ctgcagtgccagagtttccgctggtacctcgaacatgtctacccggagatgcggatctac
aacaacaccatcacatacggcgaggtgaggaacagcaaggccagtggctactgtcttgac
cagggctctgaagacgatgacaaagccatcctctacccctgccacggcatgtcctcccag
ctggcccgctactctactgaggggcttctccagctaggacccctggggtcgaccaccttc
ctgcctgacacaaaatgccttgtcgatgatggcagaggacgcactcccagtctgaaaaaa
tgcgacgcagtttcaaggatttcccagaggctctgggactttacacagaatggtccaatc
atcagcagggacactggccgatgcttggaggtagaaatgtccaaagatgccaactttggc
cttcgcctggtggtccagagatgctccggtcagaagtggatgatacgaaactggattaag
catcccaagcactga

DBGET integrated database retrieval system