KEGG   Lates calcarifer (barramundi perch): 108879100
Entry
108879100         CDS       T04895                                 

Gene name
pdgfra
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04020  Calcium signaling pathway
lcf04144  Endocytosis
lcf04510  Focal adhesion
lcf04540  Gap junction
lcf04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108879100 (pdgfra)
   04020 Calcium signaling pathway
    108879100 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108879100 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108879100 (pdgfra)
   04540 Gap junction
    108879100 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108879100 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108879100 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lcf04090]
    108879100 (pdgfra)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108879100 (pdgfra)
Protein kinases [BR:lcf01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108879100 (pdgfra)
CD molecules [BR:lcf04090]
 Proteins
  108879100 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 108879100
NCBI-ProteinID: XP_018525778
LinkDB
Position
Unknown
AA seq 1471 aa
MDEIKTSVVLGGILAVLVSVTCGLSPPTIVSNDEEFILQPNSVFNISCTGKRSVVWEEPL
PANTFVLPGYYTATLFIYNATVENTGYYMCVYETPEDEVESEPEEENEAGIYVFVPDPKA
PFVPETPDNLVVPMDMTGVPISCRVSDPFSDVILRSVPSGEEMPAYYDNKMGFFRNLSPG
QYQCETTVNGQTVRSVVYTVKVEAPAEMEDFDVEVKASEETVRAGEPFSVTCVAPTGLGF
QQQWLHPKKQAVDAVQTKQTLPDRVIYTLNILKATTQDSGTYECSITHEISREVRVSSVA
VTVIEENSFVILDHSGILATEFVSLLEETEFTILIDAYPAPKVTWLKDGKAIPGNYYVHT
KTSHFEGNRYQSILTLRQPLEKDNGNYTITALSGSRSAQFSFNLKVKAPTAMMFPPSSAP
MLLPQIDEMVVPLHTPFTLTCRGEAQLAWETPLDVLEQTQEDNSGLFVTAITVDNATAMH
TGYYTCFYSKNTTEETEDSSIYIYVPDPDVPFVPSPVPFGNHVLSDHEEMEIQCRVSDPS
ANVTLINADTQQPVPSVYDSKRGALGVFTAGTYMCKALVNGQEHYSGEYIVHGWTGGAAL
HVELTAKRTALLVGETLTVTCLARGSEILEDHWKYPGKLANRAIKTVHENKRDQEILYTL
TIPQASTKDSGIYSCSITDIISNESQTKQLAIRVFASEFLAVRPQFGEYESAELDEVREF
RAEISSFPTARVTWLKDGSPLSDVTAEISTSLRQLSETSYMSALTLIRAKEEDSGNYTMR
VQNGNQTRDVGLVLEVKVPAVIVELMDIHHGSATGQSVVCITRGQPTPVVEWFICKNIKH
CANDSSSWAPLSTNSTEITVDSHMDEDNNLESQVMFGHLENTLAVRCLARNEMAAVSREV
KLVSSGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIY
VDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR
SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFL
SLNPEKNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNASKY
SDIQRSNYDHPPSQKGSSEGEIDNLLSDDMNEGLTTTDLLSFTYQVAKGMEFLASKNCVH
RDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLS
DVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWNSE
PEKRPSFLGLSETVASLLPSSYKRHYERVNHEFLKSDHPAVTRVCMENDDAYIGITYKNQ
GKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSSST
FAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4416 nt   +upstreamnt  +downstreamnt
atggatgagataaagacgtctgtcgtcttggggggtattttggcggtgctagtttcagtt
acctgcggactgtcgccaccaactattgtgtccaacgacgaggagttcatcctgcagccc
aactccgtgttcaacataagttgcaccggtaaaagaagcgttgtttgggaggaaccccta
ccggcaaacaccttcgttttaccgggatactacacggcaacgctctttatttacaacgcg
acggtagaaaacaccggctattacatgtgtgtctacgaaaccccggaggatgaagtggag
agtgaaccggaagaagaaaatgaggcgggaatatatgtcttcgtgccagatcccaaggcc
ccgtttgttcctgagacccctgataacttggtagtccccatggacatgactggagtcccc
atctcctgccgagtatctgaccctttctcagatgtcatcctgaggagtgtccccagtgga
gaggagatgcctgcctactatgacaacaagatgggcttcttcaggaacctctctcctggg
cagtatcagtgtgaaaccactgtgaacggccagacagtcagaagtgttgtttacactgtg
aaagttgaggcccctgcagagatggaggatttcgatgtggaagtaaaagccagtgaggaa
actgtaagagctggggaacctttcagtgtcacctgtgtcgctcccactggactgggcttt
cagcagcaatggctccatcctaaaaaacaggctgtggatgcagtgcagacgaaacagact
ttacctgaccgggtcatatacacgctcaatatcctaaaagccaccactcaggacagcggc
acctacgaatgctccatcactcacgaaatcagtagagaggtcagagtcagcagcgtggcc
gtcactgtcatcgaggagaattcctttgtgatactggaccacagtgggattctagcgacg
gagtttgtcagccttttagaggagacagagtttacgattctcattgatgcttacccagcc
cctaaagtgacatggctgaaagatggcaaagccataccagggaactactatgtccacacc
aaaacaagccactttgaagggaataggtatcaaagtattctgacattacggcaacctctg
gagaaagacaatgggaattacacaattacagctcttagtggttcccgctctgctcagttc
tcctttaacctcaaagtgaaagcccccactgcaatgatgttcccaccatcctcagcccct
atgctgctgccacagatagatgagatggtggtgcccctccacactcctttcaccttgacc
tgccgtggagaagcacagctggcctgggagacaccgctcgatgtgctcgagcaaacgcag
gaggacaacagtggcctatttgtcactgccatcactgtggataatgccactgcaatgcac
actgggtactacacttgtttctacagcaaaaataccactgaggagacagaggacagcagc
atctacatctatgtgccagatccagatgttccctttgtgccatcaccggtgccttttggt
aaccatgtcctgtccgaccatgaggagatggagatccagtgtcgagtgtctgatcccagc
gccaacgtgaccctgattaacgctgacacccagcagcctgtgcctagtgtttatgacagc
aagaggggtgctttgggggtattcactgctggaacctacatgtgtaaggcccttgtaaac
ggacaggaacactacagcggggaatacatcgtccacggctggacaggtggtgctgcactg
catgttgagctgacagccaagcggactgctcttctggtaggagagactctcacagtcacc
tgtctggctaggggttctgagattctggaagaccattggaaataccctggaaaactggct
aatcgtgctatcaaaaccgtgcatgagaacaagagggatcaggagatcctttacaccctg
acaatcccgcaggcttcaaccaaagacagtggaatctactcttgctccatcactgatatt
attagtaatgagagccagacaaagcaactagctattagagtttttgcaagtgagtttctg
gctgtccggccacagtttggagaatatgaatcagcagagctggatgaggtccgcgagttc
agggccgaaatcagctccttccccactgcacgcgtcacttggcttaaagatggaagccca
ctcagcgatgtgacagcagagatctccaccagcctccggcagctcagtgagaccagctac
atgagtgctctcaccctgatccgagccaaagaggaggacagtgggaactacaccatgcga
gtgcagaatgggaaccaaactcgggatgttggtttagtgctggaggtcaaagttcctgca
gttattgtggagctgatggacatccaccatggctcagccacaggccagtctgtggtgtgc
attactagagggcagcccacccctgtggtggagtggttcatctgcaagaacatcaaacat
tgtgcaaatgactcgtcctcctgggcccccctctccaccaactccacagagatcacagtg
gactcccacatggacgaggataataacctggagagccaggtcatgtttggtcacctggaa
aacacactggccgtccgctgcctggccaggaatgaaatggctgccgtcagcagggaggtc
aaactggtgtctagcggccctcaccctgagctgactgtagctgctgctgtgctggtgctc
ctggtcattgtcatcatatcactcattgtcttggttgttatctggaaacagaaaccacgt
tatgagatccgctggagggtcatagagtctgtgagcccagatggccatgagtacatctat
gtggatcccatgcagcttccctatgactccagatgggagtttccccgtgacagacttgtg
cttggtcgtatcctgggctctggagcctttgggaaggtagtagagggcaccgcttatgga
ctcagtcgctcccaacctgtcatgaaggtggcagtgaagatgctgaaacccacagcacgc
tccagcgagaaacaagccctgatgtctgagctaaagatcatgactcatcttggacctcat
ctaaacattgtcaacctccttggagcgtgcactaagtcaggccctatctacattatcaca
gagtactgcttctatggggacctggtcaactacctgcacaagaacagagagaacttcctg
agcctaaacccagagaagaataaaaaggagctggatatctttggaatcaaccctgcagac
gagagcagcaggagctatgtgatcctgtccttcgagagcaaaggagactacatggatatg
aagcaagctgacaacactcagtatgtgcccatgctggagatgagcaatgcctccaagtac
tcagacatccagaggtccaactacgaccacccgccctcccagaaaggctcaagtgagggt
gagatagacaacctgctgtcggacgacatgaatgagggcctcaccaccaccgacctgctc
agctttacctaccaggtggccaaaggcatggagttcctggcttccaaaaattgtgtgcat
cgggacctcgcagccaggaatgtgcttctctctcagggcaagatagtgaagatttgtgac
tttggactggccagagacatcatgcatgacaacaactatgtctccaaagggagcaccttt
ctgccagtgaagtggatggcaccagagagcatttttgacaacctgtacactactctcagt
gatgtttggtcctacggcatcctcctctgggagatattctccttaggcggcaccccatac
ccaggaatggtcgtggactcgagcttctacaacaagatcaagagtggatacaggatgtcc
aaacctgaacatgcaccgcatgacgtgtatgaaatgatgatgaagtgctggaacagtgag
ccggagaagaggccttctttcctgggtctgagtgaaactgtagcttctttgctgccctcc
agctacaagagacattacgagagggtaaaccacgagttcctgaagagtgaccaccccgct
gtgactcgggtgtgcatggaaaacgatgacgcctacattggcatcacctacaagaaccag
ggcaagctaaaggacagggaaagtggcttcgacgagcagcggctgagctctgacagcggc
tacattattcccctccctgaccttgaccctatatctgatgatgaatatggaaagagaaac
agacacagctctcagacatccgaggagagtgccatcgagacgggctccagcagctccact
tttgctaagcgtgagggtgagaccctggaggacatcacgctgctggacgagatgtgtctg
gactgtagcgacttggtagaggacagctttctgtga

DBGET integrated database retrieval system