KEGG   Lates calcarifer (barramundi perch): 108879625
Entry
108879625         CDS       T04895                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04020  Calcium signaling pathway
lcf04260  Cardiac muscle contraction
lcf04261  Adrenergic signaling in cardiomyocytes
lcf04270  Vascular smooth muscle contraction
lcf04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108879625
   04020 Calcium signaling pathway
    108879625
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108879625
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108879625
   04261 Adrenergic signaling in cardiomyocytes
    108879625
   04270 Vascular smooth muscle contraction
    108879625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108879625
Ion channels [BR:lcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108879625
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 108879625
NCBI-ProteinID: XP_018526465
LinkDB
Position
Unknown
AA seq 2262 aa
MMGNAASGGGAGLGSGGGGPISTASSTQRKRQHYSSKPKKQTATTATRPPRALLCLTLKN
PIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFT
VEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGF
DVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFM
GKMHKTCFYDHGTTAEEKPAPCAPDGAYGRHCTQNGTKCTVGWEGPNDGITNFDNFAFAM
LTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE
KAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDDKPRNRVSPAHLGKK
TSKLAWFSHSTDSQDVSMPASENESVNTDNAPGGDVEGETCCTRLANRISKSKFSRYSRR
WNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHKQPQWLTDVQDIANKVLLALFT
GEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIF
KITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARLASPEKRHDNEKPPLEEEKKEKIELKSITS
DGETNTATKINMDDYCGDESEEKNPYPANDYIGDDDDDEPEMPVGPRPRPLSDIQLKEKA
VPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQ
ILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQLDFS
TSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACI
GVQLFKGKFFSCTDNSKQTQAECRGSYIMYKDRDVGKPERASRVWENSEFNFDDVLQGMM
ALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVI
VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMF
TLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVF
DFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSSSHPPVVRPMVRFDGNLVRLPT
SFTNPPSLHPSIPSSATPSMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDQTQINRNNNFQTFPQAVLLLFRC
ATGEAWQEIMLACSANRPCEKGSTNENSTSNEECGSQFAIIYFVSFYMLCAFLIINLFVA
VIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKL
CPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIW
KRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQA
GLRTLHDIGPEIRRAISGDLTVEEELDKGLKEPVSAASEDDIFRRTGGLFGNHVNYYNQS
DGRGSFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANN
TGMAGVATQGISRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRTCFYDNLMRSDSSD
SHLPIIRRGEGSTEETYDESYGDDREYHEDDHSLSSDMLVYHDETCKQLAPMEEGEQDDD
RRGGGGWQSPRRVFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGL
SPLLRRSHSPTLFSRLCSTPPASPTAHGSDASYQRVPSLRLEGSNSLEKLNTSLPSVNCG
PWYSDSNGNSRGPSPSPTPSVSVSSQRAPRPVSLTVPSLLGKDSSSLCHGSAGSLVEAVL
ISEGLGHFAQDPSFIEATKAELADACDMTIEEMEHAANNILNGNTTTNATSSTSSTSQHS
PNGNLLPFHTAAAAATHRDRVVSLSPSEGGGEAGGSRGSVHGPSSVEERQELLAGGRGQE
EEEEEAGEREEGHHRSSGVSGAARQRNSGLLEDEDMECVTSL
NT seq 6789 nt   +upstreamnt  +downstreamnt
atgatgggcaatgctgcatcaggtggaggggcagggcttgggtctggagggggcgggccc
atctccacggccagctccacgcaaaggaagagacaacactatagctctaagcccaagaaa
cagacagcgacgacagctacaaggccgccacgggccctactctgtctcacgctcaagaac
cccatccgcagggcctgcatcagcatcgtagagtggaaaccatttgagatcatcatcctg
atgaccattttcgccaactgtgtggccttagccgtctatatccccttccctgaggatgac
tcgaacgccaccaactccaacctggagcgtgtggagtatctgttcctcatcattttcaca
gtggaggcgttcctgaaggtaatagcttatggcctgctctttcaccccaacgcctacctg
aggaacggctggaatctgctcgacttcatcattgtagtcgtagggttatttagtgcgatc
ttggaacaggccaccaagggggacggggccacgcctattggtgggaaggcggcaggcttc
gatgtcaaggctctgagggcattcagagtactcagaccgctcagactggtctctggagta
ccaagtttacaggttgtgttgaactccattatcaaagccatggttcctctgctccatatt
gccctgctggtcctcttcgtcatcatcatctatgccatcatcggcctggagctcttcatg
ggcaagatgcacaagacctgcttttacgaccatggaaccactgcagaggaaaagccggca
ccatgcgcccctgatggtgcttatggtcgacactgtacacagaatggaaccaagtgcacg
gtgggatgggagggccccaatgacggcatcaccaactttgacaactttgcctttgccatg
ttaacggtgttccagtgtataaccatggagggctggacggatgtactgtactggatgcag
gatgctatgggctatgagctgccatgggtctattttgtctctctcgtcatcttcggctcc
tttttcgttctcaatctcgttctgggggtgttgagcggagagttttccaaggagagggag
aaggccaaggcacgtggtgacttccagaaactcagagaaaaacagcaactggaggaggac
ctcaagggctatttagactggatcactcaggctgaagacattgacccagagaatgaagag
gagggcatggacgatgacaaacccagaaaccgagtgtctccagcccacctgggtaagaag
accagtaagcttgcctggttcagtcactctactgactctcaggacgtgagcatgccagcc
agtgagaatgaatcagtcaacacagacaacgcccccgggggagatgtggagggggagacc
tgctgtacccggctagcaaataggatctccaaatccaagttcagtcgctactctcgaagg
tggaacaggctgtgcagaaggaagtgccgtgcggcggtcaaatcgcaggttttctattgg
ctggtcatcttcctggtgttcctcaacactcttaccatcgcctctgaacatcacaaacag
ccacagtggttaactgacgtacaagatatagccaataaggtgttgctagcactcttcact
ggtgagatgctgttgaagatgtacagtctgggcctgcaggcgtactttgtttcgctcttt
aaccgcttcgacagcttcgtagtatgtggaggaattctggagaccattctggtggaaacc
aagatcatgtctcctctcggcatctctgtgttgcgttgtgtacgcttgctacgaatcttc
aaaataaccagatactggaactcactgtccaacctggtggcctccctgctaaactctgtt
cgctccatcgcttccctgttgctcctgctcttcctcttcattatcatcttctccctgctt
ggcatgcagctctttgggggaaaattcaacttcgacgagacccgacgcagcactttcgac
aattttccccagtccctgctcacagtgtttcagatcctgactggagaggactggaactct
gtgatgtatgatggcatcatggcatacggtggaccatcattcccaggcatgctggtctgc
atctacttcatcatactcttcatatgcggaaactatatcctgctaaatgtcttcttggcc
attgctgtagacaatctggcagacgccgagagcctgacatctgcccagaaagaagaggaa
gaggagaaggagaggaaaaaactggccagactcgccagtccagagaagcgtcatgacaac
gagaagccgcctctggaggaggagaagaaggagaaaatagagctgaagtccatcacatct
gatggagagaccaacaccgctactaagatcaacatggatgactactgtggagatgagagt
gaagagaagaatccatatcctgcaaatgattatataggagacgatgatgatgacgagcca
gagatgccagtgggcccaaggccgcggccactctcggacattcagctgaaggagaaggct
gttcccatgcctgaggcccgtgctttctttgtcttcagccacaccaacaaattcagggtt
ttgtgccataagatcgtcaaccacaacatcttcaccaacctcatcctcttcttcatcctg
ctcagcagcatcagtctggcagcagaggatccggtcaagaatgactccttcagaaaccag
atcttgggctatgcagatcatgtcttcactggactcttcaccatagagatcattctcaag
atgacagcctatggagccttcctccacaaaggttcattctgtagaaactatttcaacatc
ctggacttggtggtggtcagtgtgtccctcatctcctctgggatacaactagacttctcg
acgtccagtgctattaatgtggtgaaaatcctgagagttctgcgagtgctcagaccacta
agggccatcaacagagccaaggggctaaagcacgtagtgcagtgcgtgtttgtggccatc
aggaccattggcaatattgtcattgtcaccacgttgctccagttcatgttcgcgtgtatt
ggagtacaactctttaagggcaagttcttctcctgcaccgacaactctaaacagactcag
gcagagtgcaggggctcctacatcatgtataaggacagagatgtggggaagcctgaaaga
gcttcaagagtgtgggagaacagtgaatttaactttgacgatgtccttcaaggaatgatg
gctctgtttgctgtgtctacttttgagggctggccagggttactgtaccgggccatagac
tctcatgctgaggacgttgggcccatctacaactaccgcgtggttatctccatcttcttc
atcatctacatcatcatcattgccttcttcatgatgaacatctttgttggtttcgtcatt
gtcacattccaggagcaaggagagcaagaatataagaactgtgagctggacaagaatcag
cgtcagtgtgtggagtatgccttgaaggcccgtccactgcgccgctacatccctaagaac
ccctaccagtacaaagtgtggtacgtggtcaactccacctactttgagtacctgatgttc
acactgatccttctcaacaccatctgtctggctatgcagcatcatggacagaccaaaaat
ttcaatgatgccatgaacattctcaacatgctcttcactggactcttcactgtggagatg
atccttaaactgattgccttcaaacctagggggtactttagtgatccctggaatgtgttt
gatttcctcatcgtaattggcagcataatagacgtcattctcagtgagatcaacccagct
gactcgtcctcgtcctcgtcctcctcttcttcgtcctcctcctcctcctcttcctcctct
cacccccctgtggtaaggccaatggtacgcttcgacggtaacctcgtccgcctccctacc
tccttcaccaaccctccatccctccatccttccatcccttcttctgctacgccatccatg
ggactgcagaactctgaagagaacgccaggatctccatcaccttcttccggctgttccgc
gtgatgaggctggtgaagctgctgtctcgcggggaagggattcggaccctgctgtggacc
ttcatcaaatccttccaagctctgccctacgtagctctgcttatagtgatgctattcttc
atatacgctgtcatcggcatgcagatgtttggtaagatagcgctgcgggaccagacacag
atcaacaggaacaacaatttccagacgttccctcaggcagtactgctgctcttcagatgt
gcaacaggtgaggcgtggcaggagatcatgctggcgtgctcagccaatcggccatgtgag
aagggatcgaccaatgagaacagcacatccaacgaggaatgtggcagccagtttgccatc
atttactttgttagcttctacatgctctgtgcctttctgatcatcaacctgtttgtggct
gtcatcatggataactttgactacctgacacgtgactggtcgatcctggggccgcatcat
cttgacgaattcaagaggatctgggctgaatatgacccagaagctaaggggagaataaag
caccttgatgtggtgactctgctccggaggattcagcctcccctcggctttggaaagctt
tgcccccacagggtggcctgcaagcgtctggtgtcaatgaatatgcctctgaacagcgat
ggaacagtgatgttcaatgccacactgtttgccctggtcagaaccgcactcaggattaag
acagaaggtaacctggagcaggccaatgaagaactgagggcaatagtgaagaagatctgg
aagaggaccagcatgaagctcttggatcaagtagtgccccctgctggcgatgatgaggta
acagttgggaagttctacgctaccttcctcatccaagaatatttccgcaagtttaagaag
aggaaagaacaagggctggtggccaaggtgccccccaaaactgccctctctctgcaggcg
ggcctgcggacattgcatgatattggtccagagatacggagggccatctctggagacctg
acagtggaagaggaactggataaaggcctgaaggagcctgtgtcggcagcatccgaggac
gatatcttcaggcgtacgggtgggttgtttggcaaccatgtcaactactacaaccagagt
gatggccgcgggtctttcccacagtctttcactacccagcgtcccttgcatatcagccag
aagggctcaccttgcgaaggagagagcccatcccacgagaagctcatggactcaaccact
ttcaccccttcctcatactcctcatcaggctccaatgcaaacatcaacaatgctaacaac
actggcatggctggggtagcaacccagggtatcagtcgattcccaagcccatctataagc
actgtggatgggcacacagggcagccactcacccccatcctgctgccaagatctgcgtgg
tgctttcctcctaagaggacgtgtttttatgacaacctcatgcgctcggactcaagtgat
agtcatctgccaatcatacgaagaggggaggggtcaacagaggagacctacgatgagagc
tatggcgacgacagggagtaccatgaggacgaccactcactctcctctgacatgctagtg
tatcatgatgaaacatgtaagcagttggctcccatggaggaaggagagcaggatgatgac
agaagaggaggaggagggtggcagtctcccaggagagtttttctctgccccacttctctg
gggcggagatcatccttccatcttgagtgtctcaggagacagtcaaggccagatgtctcc
cagaagacggctgtacccttacaccttgtacatcatcaggctttggcagtggcagggttg
agtcctctgctaaggaggagtcactcacctaccctcttcagccggctgtgctccacacct
ccagccagtcccacagcccatggcagtgatgcctcctaccagcgagtaccctctctgagg
ctagagggctccaactcccttgaaaagctcaataccagcttgccctctgtcaactgtggg
ccctggtacagtgacagtaatgggaacagccgagggcctagtcccagtcccacccctagt
gtgtcggtgtccagtcaaagagcaccacggccggtgtcgctcacagtgccctcgctactg
ggaaaagactccagctcgctgtgtcacggcagcgcaggcagtctggtggaggcggtgcta
atatcagagggtttgggtcatttcgctcaggacccatcattcattgaggcaaccaaagcc
gagttggctgacgcctgcgacatgaccatcgaagagatggagcacgctgccaacaacatt
ctcaatggcaacaccaccacgaacgccacgtccagcacctcctccacctcccagcacagc
cctaacggcaacctcctcccattccacacagcagcagcagcagcaacgcacagggaccga
gtggtcagcttgagtcccagcgagggcgggggagaggctggaggaagcagaggctccgtc
cacgggccgtcctcggtggaggagcggcaggagctgctagcaggggggagaggacaagaa
gaggaggaggaagaggcaggagaaagagaggaggggcaccatagaagctcaggtgtgagt
ggagcagcgcggcagaggaacagcgggctgttggaggatgaggatatggagtgtgtgaca
agtttgtag

DBGET integrated database retrieval system