KEGG   Lates calcarifer (barramundi perch): 108879632Help
Entry
108879632         CDS       T04895                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf01100  Metabolic pathways
lcf04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108879632
   00500 Starch and sucrose metabolism
    108879632
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108879632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108879632
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108879632
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108879632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 108879632
NCBI-ProteinID: XP_018526490
LinkDB All DBs
Position
Unknown
AA seq 934 aa AA seqDB search
MMGLLSTFIVAVVLLTFVLSSCLYMEHLSDHETRLVRGENGNITRGRFVNNNPAKPQNNS
LESRGIHPESSQETDIYRGNKCTMPPESRFDCARDRVLSERECKERGCCYAPLPDSAGPP
WCFYPSLYPGYKMGPFTPTTRGQAATLTRANPSYLPRDISTLSLEVTEETAGCLHLTLKD
PSSQRYEVKLPAGVPLSRAATHDALYTTEYQPDPFGFIVRRKSNGKVIMNTTVAPLLFAD
QYLQLSTTLASSLVSGLGEHYTSLLLDLNWTSLTLWNRDMAPHADANLYGSHPFYIVQEE
DGLAHGVFLLNSNAIEVILQPTPALTWVSTGGVLDLYIFLGPDPQSVTRQYLQVIGYPMM
PPYWSLGFHLCRWGYTTTNTTRRVAQRMHNANFPLDVQWNDLDYANKRRIFTFDPWRFGD
LPEMVEQFHARGMKYILILDPGISSTSRPGTYPPFDDGLKRDVFIKNATGHILIGKVWPG
PTAFPDFTNPETRQWWEDWIRDFHSKVPVDGLWIDMNEPASFVQGSVEGCPDSDLENPPY
TPRVVGGQLNSGTLCMSAQQKLSTHYNLHNMYGLTEAYATYRALTTVRAKRPFVLSRSSY
PGIGRFSGVWTGDVRSDWEQLRYSIPAVLQFSLFGVPLVGADICGFGGNTTEELCVRWMQ
LGAFYPFMRNHNDKPNAPQEPYVFGQRAQAAMQSAVNLRYSLLPFLYTLFHRAHTSADTV
ARPLFMEFPSDPNCQTIDQQFLWGSSLLISPVLEQGAVELAAYLPPGTWYSLHNGQPFYS
KGQYLLLPAPLDTINIHVREGHIIPQQEPALTTTASRRNAFSLTVALSAVGWAWGDLFWD
DGDSLDTYELGNYCYITFIAGQSQIVSDPLRLNGALDGLVLGGLRVFGVPSPPRYVLANG
DKVRDFTYRSDTKVLTVTSLALPMSKVFTVQWAL
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtctgttgtctacttttatcgtagccgttgttctccttacatttgttttgtca
agttgtttgtacatggagcacttatctgaccatgaaaccagattggttagaggggaaaat
gggaacataacacgtggaaggtttgttaataataatccagccaaaccacagaacaactca
ttggagtcaaggggaatccaccctgaaagctcccaagagacagatatttacaggggtaat
aaatgcaccatgcccccagagagtcggtttgactgtgccagggacagagttctcagcgag
agagagtgtaaggagaggggatgctgctatgcccctctgcctgactctgcaggaccacct
tggtgcttctaccccagtttgtaccctggctataaaatgggtcccttcactcccaccacg
agaggccaggctgccaccctgactcgtgccaacccctcctacctccccagagacatctcc
actctaagcctggaagtcactgaggagactgcaggctgtttgcacctcactttgaaggac
ccatcatctcagcgatatgaagtcaagctcccagctggtgttcctctgagcagagcggct
acccatgatgccctctacaccactgagtaccagcctgacccatttggtttcatagtgaga
cgtaaatccaatggaaaggtgattatgaacaccactgtggctcctttgctgtttgctgac
cagtacctgcagctgtccaccacactggcctcctcccttgtgtctggccttggggagcat
tacacgtccctcctcctggacctcaactggacttctctaactctctggaacagagacatg
gcgcctcatgctgatgctaacctctatggctcccacccattctacatagtacaggaggag
gatggcttggcgcatggagttttccttctcaacagcaatgcaattgaggtgatcttgcag
ccaacccctgcactcacctgggtgtccaccggaggagtcctggatctgtatattttcttg
ggtcctgatcctcagagtgttacacgacagtacctccaggttatcggctatcccatgatg
cctccctattggtcactgggctttcatctgtgtcgctggggttacacgaccactaatacg
acccgcagggttgcacaacgcatgcacaatgccaactttccactggacgtgcagtggaat
gatctggattatgcaaataagcgcaggattttcacttttgacccctggcgttttggggac
ctcccagagatggtggagcagttccatgcgagaggcatgaagtacatccttattctggac
ccggggatcagcagcaccagccgtcctggaacttaccctccctttgatgatggactgaaa
cgagacgtcttcattaaaaatgccacaggacacatcctgatagggaaggtttggcctggc
ccaacagccttccctgacttcaccaacccagagaccagacagtggtgggaagactggatc
agagatttccattctaaagtacctgtggatggactttggattgatatgaatgaaccagcc
agttttgtccagggctcagtggagggctgtcctgacagtgatcttgagaacccgccctac
acacccagggtggttggaggccagttgaactcaggaactctgtgtatgtccgctcaacag
aagctgtccactcactacaacctgcacaatatgtatggactgacagaagcttatgccact
tacagagctctcacgacggtacgagcgaagagaccctttgtcctgtctcgctcctcttac
cccggcatcggacgcttctctggagtgtggacaggtgatgtcaggagtgactgggagcag
cttcgatactccatccctgcggttctgcagttcagcctgttcggggtgcctctggtgggg
gcggacatctgtggctttggaggaaacaccactgaggagctgtgtgtacgatggatgcag
cttggtgccttctacccgtttatgaggaaccacaacgacaagcccaatgctcctcaggag
ccctatgtatttgggcagagggctcaggcagccatgcagagcgcagtgaaccttcgttac
tcccttctcccgttcctctacacactctttcatcgtgcacacacctctgctgacactgta
gccaggcctctcttcatggagtttccctctgaccctaattgccaaaccatagaccagcag
ttcctgtgggggagttcacttctcattagcccagttttagagcaaggggcagtggagctg
gctgcctacctaccccccggcacttggtacagtctgcacaatggccaaccattctacagc
aagggtcagtacctgctcctgccagcccctctggacaccatcaacatccatgtgagggag
ggacacattatccctcagcaggagcctgctttgacaaccacagcctcacgcagaaacgct
ttctccctgacggtggcactgtcagcggtcggctgggcctggggcgacttgttctgggat
gatggggacagtcttgacacctacgaactgggaaattactgttacatcaccttcattgct
ggacagtctcagattgtgagtgatcctctgaggctgaacggggccctggatggtctggtg
ctgggagggttgcgggtgtttggggtgccctctccaccccgttatgtattggccaatggg
gataaagtcagggatttcacgtaccgcagcgacaccaaggttttgacagtgaccagtctg
gccttgcccatgtcaaaggtgtttacggtccagtgggctctctga

DBGET integrated database retrieval system