KEGG   Lates calcarifer (barramundi perch): 108880620Help
Entry
108880620         CDS       T04895                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A-like isoform X1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108880620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108880620
Enzymes [BR:lcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108880620
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108880620
   HMT complexes
    COMPASS/SET1 complex
     108880620
    COMPASS/SET1 complex (yeast)
     108880620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 108880620
NCBI-ProteinID: XP_018527718
LinkDB All DBs
Position
Unknown
AA seq 2219 aa AA seqDB search
MDPDSGAETQKAVSLQWKSYKLVQDPAIRRVAQKIYRYDGVHFSVPDSGFPPVGELRDPR
PRRLWSRYTELSLPVPKFKLDEFYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGNIIHAQLDIKGQQRQKYYDLI
VNGSYTPQTVPLGGKALTDRLQPQTPTQPQPDTSSEIRRRLSSELAVLAAGVQALTSGNI
TPCSVDTGFSDQRLDTPPPSSMAGPYTPGSSASSQGGGTPYSSRSGTPFSQDSGYTGGRH
TGYNTGTLGSGYPPQDMLPSSSSSSAVSSTVGGYKVSRYSEDAQEPSVYHRGRPMYPPTT
SYRPNEPPCYPPYPNVGGPGPHMAHHSSMPPPPLANQYDQPPMSDRERDRDRDSGGRYAA
GGIASRRSSYHHQQDTNSSSKYHSHHSHHHSDRRDDRGYRRDSLGSRSGDHSHQRHRNHH
HSHNHHGSSSRRRSSHDRDRDRDRDRDRDRDRDRDRDSDYSNSSDPRYNSNSYRSSSNSM
SPPPSSYSAYSSSKEPAPAPPQGLDVSTRQGATSLTERGSLPSVGADKDYHAGHHSALPP
PPPPPPPLPPASVIAAAVAETLGTMDFSQDSPAREEQWTKPKRRPSTPPAPPKTPPPSSP
PHPSITSSSTSPSSTSLPHHLPSSSNSPPPPQRDSSSPEPDSTNESLPFVYHSSSLDSRI
EMLLKEQKAKFSFLASDEEDEEDRKDEKQRGTRGDRGERRGGTGDVTGEHTGGNQVGDNV
DKDHRKKGERDRDGHRGRKRGKGGEGRKSPTVLNATTPSSSTYSPHIPPPEEPQPQVGLT
GPGALQEESSQAGSAADTRSRTGAHTPPYNGQSQSSPHSSGEDMEISDEEEEETTITTAT
THQPSVTSVSSPSSSQAAMPSQTADPSSSPPPISDSAQHFGTSMHPPMPSYPPHLPPPPP
PGYSLQPPPPPGIPPLPHMELHPEYPPPMPHHMYDYATSMELMNQYSGGAPMSFQMQTHM
LSRLHQLRMSSSNGTPGPGEAATADYSSYHLHSMPPPHTHHPYMDQEGSGAGAHYDQDHR
YMPPHMPYPYADPHSTQIPPPPHHGIPPPHTGWPPHVLPPHYPSYMPPPGYGTMLPGEGD
EYRAPGEEMPMLAENPHEATVQMVLGTLIQEMKNIMQRDLNRKMVENVAFATFDEWWERK
ETKAKPFQTMVRGVSALRDDEKKEEKVNRPREPLMSLVDWAKSGGMEGFSLRGALRLPSF
KVKRKEPQELEEGDMKRPRPSTPPDEDDEAADGRMPEADRHGAERDNKRRKKKPRNRKPW
ELDSEGEETSDGSSTEKEDEEEEESEKESDDDALSADSDDESLSSSSDGSSSSASSSSSS
SEDEDEEEGERAESEGPDTMDESTMDSTTEKEDDRENNAAAGPKAEVKTGEAKDSKADAT
TAPTKRPPSPPYPRPSSPIVLVPPLKKRRKTVSFSTDENDSKAQLSTAPLSPSQVAGESP
FLSPSRAPDFSGTAAPTASTRPSQGIQLLPFASKPGEGNALIVPPSGRTQDSDESKKGPP
VSPQSTPVKSPGKRGAGKDSPKSPTPPVMVCRTVQNLPLDHASMCRMAFEEAPPPPTVNK
RSRGRPRTTSLSASSCHSLREEDEDEEESEQRLRLREQVGASSLLQLASASTTDLSVLAD
VALKMDPDAGDSEETETSDEAEEQKMEEDLFSPESLALVMSPEGVIVLMEHNYCKLPVLP
APPSTKRTSRQDSSVLLPADLNTISGVLEAPEEVIGEALPSRGDTGEYLSAMGVPCESED
VGQAAGVPPSSKKKSMIGKGFELEKDKSKKRRRKDKENLEVHHTKKQEQPGKKQKKRKLE
DSDLEEDVDVEELESGELSSSDTEDEVVEEVRKSERLFLQEAGITSSQRWPKPVPAPEPT
APKFDNRSEFEQMTILYDIWNSGLDGEDLMLLRKTYEKLLQDDHSSDWLNDTHWVNHTIT
NLPNPRRKKKNVDGQLREHVTGCARSEGYYAISRKEKDVYLDLDLPEQVIREVENVDTSG
ANRVLSERRSEQRRLLTVIGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPI
AADEMVIEYVGQNIRQMVADNREKRYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHC
CTPNCYAKVITIESQKKIVIYSKQAIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN
NT seq 6660 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacagtggggcagaaacacaaaaagctgtcagtttgcagtggaagagctac
aaacttgtccaggaccctgctattagacgggttgcacagaaaatctacagatatgatgga
gtgcatttcagtgtgccagactctggatttcctcctgtgggtgaattacgggaccctaga
ccccggaggctgtggtccaggtatacagaactgtccctgccagtgccgaagtttaagctt
gatgagttctacgtgggtcccatacccctcaaggaggtgacctttgctagactcaatgac
aacatcaaggagcccttcttggcagaaatgtgtgccaagtttggtgaggtggaggagatg
gaaattctgtttcaccccaagaccaggaagcacttgggcctggccagggtgttgttcacc
agcaccagaggagccaaggacacagtcaagcatctgcacaacacctctgtcatgggtaac
atcatccatgctcaactggatataaagggccagcagaggcagaagtattatgacctgata
gtaaatgggtcctacactcctcagacagtgcccctgggaggcaaagctttaacagacagg
ctccagcctcagaccccgacacagccacagcctgacacgtcatcagaaatcaggcggagg
ctctccagtgagcttgcagttttggcagcaggggtccaggccctcacatcaggaaacatt
acaccttgctctgtggacactggcttcagtgatcaacgtctggacacacctcccccctcc
tccatggcaggtccctacaccccgggttcctctgcttcgtctcagggtggtgggacacct
tacagctccaggtctgggactcctttctcacaagactcgggctacaccgggggcaggcat
actggctacaacactggcactttgggcagcggctaccctccccaggacatgttaccctcc
tcctcctcgtcctctgcagtctcgtctactgttggaggatacaaagtctctcgctactct
gaggatgcacaggaaccttctgtgtatcatcgaggtcgccctatgtaccccccaaccaca
tcataccgtcccaatgagccgccgtgctatcccccatacccaaatgttggagggcctggg
ccacatatggcgcaccactcctcaatgcctcccccaccccttgccaaccagtacgatcag
cccccaatgtcagacagggaacgggaccgtgacagagactcaggggggcgctatgcggca
ggggggattgcctccagaaggtcatcttaccaccaccagcaggacacaaactcttcctca
aagtaccattctcatcactctcatcaccactcggatcgcagggatgacagggggtaccgg
cgagacagcctgggatcccggtcaggtgaccatagccaccagaggcatcgcaaccaccac
cattctcacaaccaccatggcagcagcagccgcagaaggagcagccacgacagggaccga
gacagagatagagacagagaccgggatagagacagagaccgggacagagacagtgactac
tccaatagttctgaccccagatacaattccaactcctaccgctcttcctctaacagcatg
tctcccccaccctcatcttattctgcatactcctcctccaaagagcctgccccagcccct
cctcagggattggacgtttccacccgtcaaggggccacaagtctcacagagaggggctct
ctaccttcagtaggtgctgacaaagactatcatgctggtcaccacagtgctctgcctcca
cctccacccccgccaccgcccctccctccagcctctgttattgcagcggctgtagctgag
acactcggaacaatggacttcagccaggatagtccggcccgcgaagaacagtggacaaaa
cccaaacgccgtcctagcaccccacccgcgccaccgaagacgcccccgccttcttccccg
ccccacccctccatcacttcctcctctacctccccttcgtccacctcactcccccatcac
ctcccctcttcctcaaactccccaccacctccccaacgtgactcctcttcaccagagcca
gattccaccaatgagagtttaccattcgtctaccacagcagcagccttgactctcgtatt
gagatgctcctaaaggaacagaaggctaaattttctttcctcgcctctgacgaggaagat
gaggaagataggaaagacgagaagcagagggggacacgtggggacagaggagaacgaaga
ggtgggacaggtgatgtaacaggggagcacacaggtggtaatcaggtgggagacaatgtg
gataaggaccacaggaagaaaggggaaagagacagagatggccacagaggaaggaaacgg
ggaaagggaggagagggtaggaaaagtcctactgtacttaatgcaaccacaccatcctcc
tccacctattctccccatatcccaccaccagaggaaccccagccccaggttggcctcaca
gggcctggagctttgcaggaggagtcctcacaggctggatcagctgctgatacacgcagc
aggacaggagcacacacaccaccttataatgggcagagtcagtcctcccctcattcctca
ggggaagacatggagatctcagatgaggaggaggaggagactaccataacaacagcgacc
acccaccagccctcagtcacttcagtttcctcaccctcttcatcccaggctgccatgcct
tcacaaacagctgacccctcttcctcacccccacccatctctgactctgcacagcacttt
ggcacctccatgcaccctcccatgccctcctatcctcctcatttgcctcctcctcctccc
cctggttattccctccagcccccacctccaccagggatccctcctcttccccacatggag
ctgcaccctgagtatccgcctcccatgccccaccacatgtatgactatgccacctctatg
gagctgatgaaccagtacagtggtggagctcccatgtccttccaaatgcagacccacatg
ctaagtcgcttacaccagctgcgcatgtcgtcatccaacggcaccccaggccctggtgag
gcagccactgctgactactcttcctatcatctccactctatgccaccaccccacacacac
cacccctacatggaccaagaggggagcggggcgggcgctcattacgaccaggaccaccgc
tacatgccccctcacatgccatacccctacgccgacccccacagcactcagataccaccc
cctccacaccatggcatccctcctccccatacaggctggccaccacatgtcttaccacca
cactacccctcttacatgcccccaccgggctatggcaccatgctgcccggggaaggagac
gagtacagggctccaggggaggagatgcccatgttggctgagaatccacatgaggccaca
gtgcagatggtcctgggcactctgatccaggaaatgaaaaacatcatgcagagggacctg
aaccgcaagatggtggagaacgttgcctttgccacctttgatgaatggtgggagaggaaa
gagaccaaggccaagcccttccagacaatggtaaggggggtatctgccttgcgggatgat
gagaaaaaagaagaaaaggtcaaccgtccacgggagcctctcatgtctcttgtggattgg
gcaaagagtggtggcatggagggcttttctctccgaggagcattacgactgccttccttc
aaggtgaagaggaaagaacctcaagagcttgaagagggagacatgaaaaggccacgaccc
tcaactccacccgatgaggatgacgaagctgctgatgggagaatgccagaggcggacagg
catggagctgaacgggacaacaagaggagaaaaaagaagccaagaaatcgtaaaccctgg
gagcttgacagtgagggagaggaaacatcagatggctcctcgactgaaaaggaggatgag
gaagaggaagaaagtgaaaaggagtctgatgatgatgcccttagtgccgatagtgatgat
gagagcctctcctcgtcctctgacggctcttcctcttcagcctcctcatcttcgtcttcc
tctgaggatgaggatgaagaggaaggagagagggctgagagtgaaggaccagacaccatg
gatgaatcaaccatggacagcacaacagagaaagaggatgacagggaaaataacgcagct
gctggtccaaaggccgaggtcaaaacaggtgaagcgaaggacagcaaggcagatgcaaca
acagcacccactaagcggcctccatcgccaccatacccacgtccttcgtctcctattgtt
ctcgtgccccctctcaagaaacgcaggaaaactgtctcgttctccacggatgagaatgac
agcaaagcacagctgtcgactgcaccgctctctccctcacaagtggcgggtgaatctccc
ttcctctctcctagcagggccccagacttttctggcactgctgccccaaccgcctcaact
cgtcccagtcaaggcatccagctgctcccctttgcctcaaaaccaggtgaaggaaatgcc
ctcattgttcccccatctggacgaactcaagactctgatgaatccaaaaagggaccccct
gtttctccccagagcacccctgtcaaatcccccggcaaacgaggtgcaggcaaagactcc
cccaaatctcccacccctcctgttatggtgtgccgcactgtgcagaacctgccattggat
catgcttctatgtgcaggatggccttcgaggaggcccctcctccacctaccgttaataag
cggtccagaggcagacctcggacaaccagcttgtctgcttcatcctgtcactccctcaga
gaggaagatgaggatgaggaggaaagtgagcagaggttaagactcagagagcaggtggga
gcgtccagccttctgcagctggcttcagcttcaaccactgacctgtctgtgttggctgac
gtagccttgaaaatggaccctgatgctggggactcagaggagacagagacatctgacgag
gcagaggagcagaagatggaggaggatctcttctccccagaatcactggccctggttatg
agcccagagggtgtaattgtcctaatggagcacaactactgcaaactccctgttctccca
gcaccacccagtaccaaaaggacttccagacaagactcttccgtcttgctcccagcagac
ctcaacaccatttctggggtgcttgaagctccagaggaggtcattggagaggccctacca
tccaggggagatacaggagaatacttgtctgcaatgggagtaccctgtgagtctgaggat
gtgggccaggctgcaggtgtacccccatcatcaaagaagaagagcatgattggcaagggt
ttcgaacttgagaaggacaagagcaaaaagaggaggagaaaagacaaagaaaatcttgag
gttcatcacacaaaaaaacaggagcagccaggcaagaaacagaagaagcggaaactagag
gactcagacttggaggaagatgtagatgtggaggagctcgagtctggggagctgtctagc
tcagacacagaggatgaggtggttgaggaggtgaggaagagcgagcgcctctttctgcag
gaggcagggataacgtcgtcccaacgctggcccaaacctgttccagcacctgagcctaca
gcccctaagtttgacaaccgcagtgagtttgagcagatgaccatcctttatgacatctgg
aactctggtctggatggcgaagacttgatgttgctgaggaagacttatgagaagcttcta
caggacgaccacagctctgactggctcaatgatactcactgggtcaaccacactataacc
aatttgccaaaccctcggcgtaagaagaagaacgtggatggacagcttcgtgagcatgtg
actggttgtgccaggagcgagggctactacgccatcagccgcaaggagaaggacgtctat
ctggacctggatctgcctgagcaggtcatacgggaagtggagaatgtcgacacctcgggg
gccaaccgggtgctatcagagagacgctcagagcagcgccgactcctcaccgtcatcggc
accacggctgtcatggactctgacctgcttaaactcaaccagctgaagttccgcaagaag
aagcttcgttttggacgcagcaggatccacgagtggggcctgttcgccatggagcccatt
gctgctgatgagatggtcatcgagtacgtgggtcaaaacatcagacagatggtggctgac
aatcgggagaagcggtacgcacagcagggcatcgggagcagctacttgttcagagtggac
cacgacacaattatagatgctaccaagtgtggcaacctggctcggttcatcaaccactgc
tgcactccaaactgctacgccaaggttatcaccatagagtcccagaaaaagattgtgatc
tactcaaagcaggccatcgctgtcaatgaagaaatcacctacgactacaaattccccctg
gaggagaacaagatcccctgcctgtgtggaacagagaactgccgtgggacactcaactag

DBGET integrated database retrieval system