KEGG   Lates calcarifer (barramundi perch): 108880720Help
Entry
108880720         CDS       T04895                                 

Definition
(RefSeq) trypsin-2-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108880720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcf01002]
    108880720
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108880720
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108880720
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108880720
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108880720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108880720
NCBI-ProteinID: XP_018527902
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
MVTEIVGGYECKPYSQPHQVSLNSGYHFCGGSLVSENWVVSAAHCYKSRVEVRLGEHNIR
VTEGTEQFISSSRVIRHPNYSSYNINNDIMLIKLSKPATLNQYVQPVALPTSCAPAGTMC
KVSGWGNTMSSTADRNKLQCLDIPILSDRDCDNSYPGMITQAMFCAGYLEGGKDSCQGDS
GGPVVCNGELQGVVSWGYGCAEKDHPGVYAKVCIFNNWLERTMASY
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggttactgagatcgtcggagggtatgagtgcaagccctactcccagccccatcaggtg
tctctgaactctggctaccacttctgtggaggctccctggtcagcgagaactgggttgtg
tctgctgctcactgctacaagtcccgtgtggaggtgcgtctgggcgagcacaacatcagg
gtcactgagggaaccgagcagttcatcagctcctcccgtgtcatccgccaccccaactac
agctcctacaacatcaacaatgacatcatgctgatcaagctgagcaagcctgccaccctc
aaccagtacgtgcagcccgtggctctgcccaccagctgtgcccccgctggcaccatgtgc
aaagtctctggctggggcaacaccatgagctccactgctgacaggaacaagctgcagtgc
ctggacatccccatcctgtccgacagggactgtgataactcctaccctggaatgatcacc
caggccatgttctgcgctggatacctggagggaggcaaggactcttgccagggtgactct
ggtggtcccgtcgtgtgcaatggtgagctgcagggtgttgtgtcctggggctacggatgt
gccgagaaggaccaccctggtgtctacgccaaggtctgcatcttcaacaactggctggag
aggaccatggccagctattaa

DBGET integrated database retrieval system