KEGG   Lates calcarifer (barramundi perch): 108880954Help
Entry
108880954         CDS       T04895                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00030  Pentose phosphate pathway
lcf00051  Fructose and mannose metabolism
lcf00052  Galactose metabolism
lcf01100  Metabolic pathways
lcf01200  Carbon metabolism
lcf01230  Biosynthesis of amino acids
lcf03018  RNA degradation
Module
lcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108880954
   00030 Pentose phosphate pathway
    108880954
   00051 Fructose and mannose metabolism
    108880954
   00052 Galactose metabolism
    108880954
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    108880954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcf01009]
    108880954
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lcf03019]
    108880954
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     108880954
Protein phosphatases and associated proteins [BR:lcf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108880954
Messenger RNA biogenesis [BR:lcf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     108880954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 108880954
NCBI-ProteinID: XP_018528224
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MAGAAAPKRQDTRKFFENLSGAGKSIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRNITN
LCVIGGDGSLTGANLFREEWSGLLDELLQQGLIDEEAAQRNSALHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDSMCQKLSENRADKKRLNIIIVAEGAIDSHNKAITPDYIKDLVVRCLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASANTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSYRKADSELPNSSFNVAVMNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKR
TLPGKHLDKIAEQMRIHNINALLVIGGFEAFESLLQLYEARADYEEFCIPMCMLPATISN
NVPGTDLSIGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
TVYIYEEPFDIRDLQANVEHLTQKMKTSIQRGLVLRNENCNENFTTDFIYQLYTEEGRGV
FDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAMQWITRTLKDSYKGGRVFANSEETACLL
GMRRRAMVFQPVSQLRDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVT
RVRPKESNTSSAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggctggagctgcggcgccgaagcggcaggacacccggaaatttttcgagaatttatcc
ggcgctggtaaatccatcgcggtgctgacgagcggaggagatgcccaaggcatgaatgca
gccgtcagggcagtcgtccgaatgggcatctacgtgggagcaaaggtctacttcatccac
gagggttaccaggggatggtggacggtggagacaacatcaaagaggcgacgtgggaaagc
gtctccagcatgctgcaagtgggtggtacggtcatcgggagcgcccgctgtaaagagttt
cgtactcacgagggccgcttgaaggcggcacacaacctcgtgcagcgcaacatcaccaac
ctgtgtgtgattggtggagacggcagcttgaccggagctaacctgttcagggaggagtgg
agcggcctgctcgatgagctcctccagcaaggtctgattgatgaggaggcagcccagcgt
aactcagcgctccacatcgtcggcatggtcggctccatcgacaacgacttctgcggcacc
gacatgaccatcggcaccgactcggccctgcatcggatcatcgaggtggtggacgccatc
atgaccactgctcagagccaccagaggacatttgttctggaggtcatggggagacactgc
ggatacctggccctggtcagtgccctggcatgtggagctgattgggtttttatccctgaa
atgcctcctgaagatggatgggaggacagcatgtgtcagaaactgtctgagaaccgcgcc
gataagaaaaggctgaacattataattgtagccgagggtgccatagatagccacaacaag
gctataactcctgattatatcaaggatctggtagtccgctgcctgggttttgacaccagg
gtcaccatcttgggccatgtgcagagaggtggaaccccctctgcttttgacaggatcctg
gccagtcgtatgggcgtggaggccgtgctggcgttattggaggcgtctgccaacaccccg
gcctgcgtcgtgtctctggttggcaaccaggctgttcgactgccacttatggagtgtgtt
cagatgactcaagaagtgcagaaggccatggatgagaagaaatttgacgaggcagtcaga
ctgcgtggcaggagctttgaaaacaacctgagcacctacagactcctctcctacaggaaa
gcagactctgaactcccaaatagctcgtttaacgtggcggtgatgaacgtgggtgcaccg
gcagcaggtatgaacgccgccgtgcgctctgctgtcagagtgggaatcactgagggccac
aaaatgtttgctgtcaacgacggctttgaaggattttacaaaggacagatcaaggagatc
aaatggggagatgtaggaggttggactggccagggagggtcgctgctagggacaaaaaga
actctcccaggcaaacatctggataagattgctgagcagatgaggatccacaacatcaat
gccctgcttgtcatcggaggattcgaggcatttgagtccctgctgcagctgtacgaggcc
cgggccgactacgaggagttttgcatcccgatgtgcatgctgcctgcaaccattagtaac
aatgtgcccggcaccgacctcagtatcggcgctgacacgtctctcaacgccatcgtggag
acatgtgaccgcatcaagcagtcagccagtggcactaagcggcgtgttttcatcattgag
actatgggaggctactgtggctacctggccactgtgggcggcctggctgcaggtgctgac
accgtctacatctacgaggagccgtttgacatccgggacctgcaggccaacgtggagcat
ctgacgcagaagatgaagacgagcatccagagaggcttggtgctcaggaatgagaactgc
aatgagaacttcaccactgatttcatctaccagctgtacactgaggagggtcggggagtg
ttcgactgtaggaagaacatcctcggtcatatgcagcagggaggagctccgtctccattt
gatagaaactttggcaccaaagttgctgctaaagccatgcagtggatcacacgaacactc
aaggactcttacaaaggagggcgagtgtttgctaactcagaggaaactgcctgcctgctg
gggatgcgtcgcagagctatggtctttcagcctgtatcacagctccgggatgagactgac
tttgtccacaggatcccgaaggagcagtggtggctgaagctccgtccactgatgaaaatc
ctggccaagtacaagacgagctacgacgtgtccgactctggccagctggaacatgtgacc
cgggtccgacccaaagagagcaacacctcgtcagccatctga

DBGET integrated database retrieval system