KEGG   Lates calcarifer (barramundi perch): 108881009Help
Entry
108881009         CDS       T04895                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00500  Starch and sucrose metabolism
lcf01100  Metabolic pathways
lcf04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108881009 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108881009 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108881009 (gys1)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108881009 (gys1)
Glycosyltransferases [BR:lcf01003]
 Polysaccharide
  Storage polysaccharide
   108881009 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 108881009
NCBI-ProteinID: XP_018528262
LinkDB All DBs
Position
Unknown
AA seq 711 aa AA seqDB search
MPLARSLSATSLSGLEEWDEDFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVMKRTIDKMNSSGCKIYFGRWLIEGSPYVVLIDVG
FTAWSLDRWKSELWELCDIGVPWFDREANDAVLFGFLTAWLLGEYTAQCEDPPHVVAHFH
EWLAGLGLVLCRQRQLSVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAVHEFQNLHAQS
KNRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDISKML
DKEDFTIMKRAIFATQRQCQPPICTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYTAARHMALAKAFPDTYLYEPQEPTSTTGFRYPRPASVPPSPALSRHSSPHHSEAE
DNDEEERYDEDLEAEKDRVNIRQPYTTPFKNKSPAIYGGNSNGDGVTNEKN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctctctgccacgtccctctcaggactggaggagtgggatgag
gactttgatttggaggatgctgttctttttgaaatcgcctgggaggtcgctaacaaagtt
ggaggcatctacaccgtcatccagaccaaagcccgtctgacctcagaggaatggggggag
aactatttcctggtgggtccctacgtggagagcaacgtgcgcactcaggtggagctgatc
gagcccaccaaccccgtgatgaagagaaccattgacaagatgaattccagtgggtgtaag
atctactttggccgctggcttattgagggcagtccctacgttgttctgatcgatgtcggg
ttcactgcctggtctctggaccgctggaagagcgagctttgggagctttgtgacatcggc
gtgccttggttcgaccgcgaggccaacgacgctgtgctgttcggattcctgacggcctgg
ctcctgggagagtacacagctcagtgtgaggaccctccacatgttgttgcccatttccac
gagtggttggccggcctgggcctcgtgctgtgtagacagagacagctgtccgttgcaacc
atcttcaccactcatgctacactgctgggacgatatctgtgtgctggaaatgtggacttc
tataacaaccttgcagagttcaatgtggataaggaagcaggcgacagacagatctaccat
cgctactgtttggagcgggcagctgctcactgtgcccacgtcttcaccaccgtatcacaa
attacagccattgaggcagagcacctgctcaagaggaaaccagacatcgtcacccccaac
gggctcaacgtgaagaagttctcggccgtgcacgagttccaaaacctccacgctcagagc
aagaatcggattcaggagtttgtcaggggacacttctacgggcaccttgacttcaaccta
gacaagtgtttgttcctcttcattgctggaaggtacgagttctccaacaaaggagcggat
atcttcctggaggctttagccagactcaactatctactgagagtcaaccacagtgatgta
accgtcattgcgttcttcatcatgccagctcggacaaacaacttcaacgttgagacctta
aagggccaggcagtcaggaaacagctctgggatacagctcagactgtgaaggaacgcttc
ggaaagaaactctatgagtctcttctagttgggcagctgccagatatatcaaagatgttg
gacaaagaggatttcaccataatgaagcgcgccatctttgcgactcagaggcagtgccag
cctccgatctgcacccacaacatgctggaggacagcagtgaccccatcctcaactgtgtc
cgccgcatcggccttttcaacagctctgctgaccgtgtcaagatcatcttccatccagag
ttcctgtcgtccacctctcctttactcccgatggattatgaggagtttgtaagaggctgc
catcttggtgtcttcccctcttactacgagccttggggctacacaccggctgagtgcaca
gtcatgggaatcccatcgatttcaactaacctgtcaggcttcggctgtttcatggaggaa
cacatagcagacccctcagcatacggtatttacatcctggacaggcggtttcggggggtc
gacgagtcatgtaaccagctcacttccttcctgttccagttctgcaagcagagccgacgc
cagcggatcatccagaggaaccggactgagcgcctgagtgacctcttggactggagatac
ctcggcaggtattatacagctgctcgtcatatggccctggctaaagccttccctgacact
tacctatatgaaccccaggagcccacctcaaccacaggtttccgctacccccgacccgcc
tctgtgccgccgtccccagctctgtcccgccactcctccccccaccacagcgaggccgag
gacaacgacgaagaggagcgctatgacgaggacctggaggcagagaaggaccgggtgaac
atccgccagccctacaccacgccgttcaaaaacaagtctcctgccatctacgggggcaac
agtaacggcgacggcgtcacgaacgagaaaaactga

DBGET integrated database retrieval system