KEGG   Lates calcarifer (barramundi perch): 108881204Help
Entry
108881204         CDS       T04895                                 

Gene name
gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf00520  Amino sugar and nucleotide sugar metabolism
lcf00524  Neomycin, kanamycin and gentamicin biosynthesis
lcf01100  Metabolic pathways
lcf01200  Carbon metabolism
lcf04910  Insulin signaling pathway
Module
lcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108881204 (gck)
   00052 Galactose metabolism
    108881204 (gck)
   00500 Starch and sucrose metabolism
    108881204 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    108881204 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108881204 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108881204 (gck)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     108881204 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108881204
NCBI-ProteinID: XP_018528567
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MPCVSSHLDQMVKMPCNYGSVLDKILMVEQILSEFRLNKEDLKEIMERMQHEMDRGLRIE
THEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVIVGEDEERSWKVETKNQMY
SIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILINWT
KGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEEFRLEYDRVVDETSINPGHQL
YEKVISGKYMGELVRLVLMKLVNEDLLFNGEASEQLKTRGSFETRFVSQVESDTGDRKQI
YNILSSLGVLPSELDCDIVRLVCESVSTRSAHMCGAGLAGVINRMRERRCQEALKITVGV
DGSVYKLHPCFRDKFHKIVRDLTPHCEITFIQSEEGSGRGAALISAVACKMAACMLTQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtcagctctcatcttgaccagatggtgaagatgccttgtaactacggctct
gtgcttgataaaatcctcatggtagagcagatcctgtcagagttcagactgaataaggag
gacctaaaagaaattatggagaggatgcagcatgaaatggacagaggactgcgtatagag
acacacgaggaggccagtgtcaaaatgcttccgacttatgtctgctccacccctgaggga
tcagaggtgggcgatttcctggctctggacctgggtggtacaaacttccgtgtcatgctg
gtcatagtgggtgaagatgaggaaaggagctggaaggtggagaccaagaaccaaatgtac
tccattcctgaagatgccatgacagggactgctgaaatgctgtttgactacatagcagag
tgtatgtcagactttctggacaaacaccatatcaagcacaagaagcttcctctgggtttt
accttctcctttccagtacgacatgaggacattgacaagggtatcctgattaactggact
aaaggcttcaaggcttctggggcagaagggaacaatattgtgggtttactcagagatgcc
atcaagagacgaggggactttgagatggatgtggttgccatggtgaatgacacagtagca
accatgatttcctgttattacgaggatcgcagctgtgaagttgggatgattgttggtact
ggttgtaatgcatgttacatggaggagatgaggactgtggagttggtagaaggggaggag
ggccggatgtgtgtgaacactgagtggggggcgtttggagacaacggggagctggaggag
ttcaggctggagtacgacagagtggtggatgagacctcaattaaccctggacaccagcta
tatgagaaggtgatcagtgggaagtatatgggtgagttggtcaggcttgttctgatgaag
ctggtgaatgaagacctgctgttcaatggtgaggcctcagagcagctgaagacacgtggc
agctttgagacgcggttcgtctcacaagtggagagtgacactggtgacagaaaacaaatc
tacaatatcttgtcctcactgggtgttctgccatcagagctggactgtgacattgtgcgt
ctggtctgtgagagcgtttcaactcgctctgctcacatgtgtggtgcggggctcgctggt
gtgatcaaccgaatgcgggagcgacgctgccaggaagcccttaagatcacagtgggggtt
gacggatcggtctacaagctgcacccatgtttccgtgacaagttccacaaaatcgtcagg
gacctcacgcctcactgtgagatcaccttcatccagtcagaggaggggagtggtcgtgga
gcagcccttatctcagcagtggcctgtaaaatggctgcctgcatgctgacacaataa

DBGET integrated database retrieval system