KEGG   Lates calcarifer (barramundi perch): 108881329Help
Entry
108881329         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcf01002]
    108881329
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108881329
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108881329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a Trypsin_2 DUF1986 SEA YqhR
Motif
Other DBs
NCBI-GeneID: 108881329
NCBI-ProteinID: XP_018528786
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MEVKKDGGGGGGPWSSSSPACYRSTVVASLFFFLVVGVFVGLIIAYLVQEQHYFMETVEL
KGLKYDPVLQDENSGFSIVLSTVLKSKIKNVFAASSISHHYLDCSIVAYGNTNGDVMVTF
RLLFRVSKVQQYSDSFVQDLLRAGFSSVMHGKPLEVPEFGQINTIVLLGASGKSFYTIGD
EMIARCPDNTFTCDNGECITKLNPECDFIPDCADGSDEARCACGTRPAMGSRVVGGEDAR
QGELPWQVSLRHHGRHTCGASIISERWLVSAAHCFERDNDPREWTALVGASLVSGEESES
KAINIKSLVVSPDYNPMTTDNDVTVLELETPLTFSSYIQPVCLPSQSHVFVPGQSCVVSG
WGALHQFNSEVPPTLQKAVVKIIDSKVCNKSSVYRGAVTHNMMCAGFLQGKVDSCQGDSG
GPLVCEGAPGRFFLAGVVSWGVGCAQINRPGVYSRVTKLRNWILSHTDPSLVRYHSQDVP
TVPDTVTELGFNNPPAPTTIGIDVSSTPAQPVLNCSGNFQCSATSCISKINPECDGVPDC
PNQADERNCDCGVRPALGSNRIVGGVTARRGEWPWIGSLQYQRLHRCGATLIHSKWLLTA
AHCFKSDSSPTNWAVSLGSVLRSGVGALVIPIQRIITHPAFNGTNMDYDVALLELAVPAP
MSYTIQSVCLPSPVHRFLKDAECYIMGWGSMREGGSLTNLLQKAAVNIIDQADCQQSYRN
VLTPNMMCAGYMEGGRDTCLGDSGGPLTCRRLSGQWFIAGVTSWGHGCGRIGYPGVYTRV
TSVRKWISTYLPF
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagaaggatggaggaggaggaggagggccgtggtcgtcttcttctcctgcc
tgctacaggagcaccgtcgtggcctcgctcttcttcttcctcgttgtcggagtctttgtg
ggcctgattattgcatacctggtgcaggagcagcattatttcatggagacggtggagctg
aagggtctgaagtatgatcctgtcttgcaggatgagaactctggtttctccatagtactg
tccacagttttaaagtccaagattaaaaatgtctttgctgcctcatcaatatcacatcac
taccttgactgtagtattgttgcctatggtaacactaatggtgacgtgatggtgacgttc
agactgctcttcagggtctccaaggtccagcagtattcagacagctttgttcaggacctg
ctgagagcagggttcagctcagtaatgcacgggaagccactagaggtgccagaatttgga
cagatcaacactatcgtcttactgggtgccagtgggaagtcattttacactattggagat
gagatgattgccaggtgtcctgacaatactttcacctgtgacaatggggaatgtatcacc
aaattaaatccagagtgcgacttcatccctgactgtgctgatggatctgatgaggctcga
tgtgcctgcggcacacgtcccgccatggggagtcgggtggtgggtggagaggatgctcga
caaggggagctgccatggcaggtcagtctgaggcaccatggacgccacacctgtggagcc
tccatcatcagtgaacgctggctggtcagtgcggcacactgctttgagagggacaatgac
cccagagagtggacggctctggtgggggccagcttggtgagcggtgaggagtccgagtcc
aaggcgattaacatcaagtcactggtcgtgtctccagactacaaccccatgaccactgat
aacgatgtaactgtgctggagctggagacccccctcaccttcagctcttacatccagcct
gtctgcttgccctcccagtctcacgtctttgttccgggccagagctgcgtggtgtcaggg
tggggcgcgttacatcagtttaacagcgaggtgcctcctacgctgcagaaggctgtggtg
aaaatcattgactccaaggtgtgcaataaatcgtctgtgtacagaggtgctgttactcac
aacatgatgtgcgccggattcctgcagggcaaggtggactcgtgtcagggtgactcaggg
gggcctcttgtgtgtgagggggccccgggaaggttcttcctagccggtgtggtgagctgg
ggcgtgggctgtgcccagatcaacaggcctggggtttattcccgtgttaccaagctccgc
aactggattctaagccacacagatcccagcttggtccgttaccactcccaggatgttccc
acagtcccagataccgtgacagaactgggctttaataatccgcccgcacccacgaccata
ggcatcgatgtatcgtccacaccagcacaacctgtcttgaactgcagcggaaacttccag
tgtagcgccacctcctgcatcagcaagataaacccagagtgtgatggagtcccagactgt
cccaaccaggcagacgagagaaactgtgactgtggtgtgcgtcctgcactgggctccaat
aggatcgtgggtggagtcacggctcgaagaggggaatggccttggatcggtagtctgcag
taccagaggcttcaccgctgtggtgccacactcattcatagcaaatggttactgactgca
gcgcactgcttcaaaagcgattcaagccccactaactgggctgtgagcctgggatccgtg
ctgcgctctggggtgggggccctggtcatccccatccagaggatcatcactcacccagct
ttcaatggcaccaacatggactacgacgtggctctgttggagctggcagtcccggccccc
atgtcctacaccatccagtctgtctgtctcccctcaccggtgcaccgcttcttgaaggat
gcagagtgctacatcatgggctggggatccatgagggaaggaggttcattgaccaacctg
ctgcagaaagctgcagtgaacatcattgaccaggcagactgccagcagtcgtatagaaat
gtgctgactcctaacatgatgtgtgctggttacatggagggaggccgggacacctgtttg
ggagactctggagggccgctgacttgtcgtcggctctctggccagtggtttattgctgga
gtgaccagctggggacatggatgtgggcgaataggttatccaggggtttatactcgtgtg
acatctgtcaggaaatggatatctacatacctgcctttctga

DBGET integrated database retrieval system