KEGG   Lates calcarifer (barramundi perch): 108882042
Entry
108882042         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04137  Mitophagy - animal
lcf04210  Apoptosis
lcf04218  Cellular senescence
lcf04620  Toll-like receptor signaling pathway
lcf04621  NOD-like receptor signaling pathway
lcf04622  RIG-I-like receptor signaling pathway
lcf04623  Cytosolic DNA-sensing pathway
lcf04625  C-type lectin receptor signaling pathway
lcf04920  Adipocytokine signaling pathway
lcf05132  Salmonella infection
lcf05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108882042
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108882042
  09143 Cell growth and death
   04210 Apoptosis
    108882042
   04218 Cellular senescence
    108882042
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108882042
   04621 NOD-like receptor signaling pathway
    108882042
   04622 RIG-I-like receptor signaling pathway
    108882042
   04623 Cytosolic DNA-sensing pathway
    108882042
   04625 C-type lectin receptor signaling pathway
    108882042
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108882042
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108882042
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108882042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcf03000]
    108882042
Transcription factors [BR:lcf03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108882042
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108882042
NCBI-ProteinID: XP_018529786
LinkDB
Position
Unknown
AA seq 638 aa
MEGVYPWGLTPLNPVQTANPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHP
AIKVHNYNGPLRVRISLVTKNAPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNISEAKVWEEEFDLNSVRLCFQASITLPTGELFPLEPVV
SQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLTEPIRVKMQLRRPSDREVSEPMDFQYLPADPDEYRLS
EKRKRTGDMFQSLKLGPMLSSVSIPQDRRHISPARRTVTAKPPSMNPQAAAVVPPSASAV
KPQPSYSYNQPGQIFSVQPKAEASSSISAATTNQTWKIMESLKLDTRPKATPVTNFTMSQ
PPSSSSSSSTTTTSSANQDYSTVNLSDLHEFFPNISSAMAQEPTASQGSTVSSQASTSFT
LQSSQFRVDPPIVDDDIPEFPSFPEAQAPGTLDSLNMDDFEDLLNHRLMSEGGNVASMLA
QAPCQQAAPPTSSTAAQSNTVSQNTSDPASNPGSTWMNYPNSIVSLLQNESMIDIASNNS
HRAPVLDEFDELMSADEDRLISIFNSESQAGFVSGHPT
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggaaggtgtgtatccatggggcctgaccccactcaacccagtccaaacagcaaacccc
ttcatagagatcattgagcagccaaagcagagggggatgaggtttaggtataagtgtgaa
gggcgttcggccggcagcatccccggagagaagagcaacgacaccactaagactcaccca
gccataaaggtgcacaactacaacggtcccttgcgtgttcgtatctcattggtaacaaag
aatgctccacacaagcctcacccccacgaactggttggtaaggactgcaaacatggctac
tacgaggccgacctgcaagaaagacgaatacacagttttcagaacctgggcatacagtgt
gtgaagaaaaaggatgtgaatgaggccataacttgcaggttgcagaccaataataacccc
ttcaacatttcagaggcgaaggtgtgggaagaggagtttgacctgaattcagttcggctt
tgcttccaggcctccatcactctgcctacaggggagctgtttcctctggagcctgtggta
tcccagcccatttatgacaacagggcccctaacacagctgagctgaagatctgcagagtc
aaccgcaactctggaagctgcaagggaggggatgaaatctttctactgtgtgacaaagta
caaaaagaggacattgaggtgcgtttcttccaggactcctgggagggaaagggcactttc
tcccaggccgatgtccacaggcaggtggccatcgtgttccgcacgccgccctaccgcgac
actaatctcactgagcccattagagtcaagatgcagctccgccggccctctgatcgcgag
gttagcgagccaatggacttccagtacctgcccgctgacccagatgaatacagactgagt
gagaagagaaagcgtacaggagacatgttccagagcctgaagcttgggcccatgctgtct
agcgtgtccattccacaagatagacggcacatcagcccagcgaggagaacagtcacagcc
aagcctccatcaatgaacccacaagctgcagctgtggtgccccctagtgctagtgcagtg
aaaccccagccctcctactcatacaatcagccaggccagatcttctcagtccagcctaag
gcagaggcctcctcctccatctcagctgcgactacaaaccaaacatggaagatcatggag
agcctgaagctggacacccggcccaaagccactccagtgaccaacttcacaatgagtcag
ccgccttcctcctcctcctcctcctccaccaccaccacctccagcgccaaccaggactac
tcaactgtcaacctgtcagaccttcatgaattcttccctaacatttcctcggctatggcc
caggagcccacagcttctcagggaagcacagtttcctcacaggccagcacctccttcacc
ctgcagagctctcagttccgggtggacccaccaattgtggatgatgatatcccagagttc
cctagctttcccgaagcccaagccccaggcaccctggacagcctaaacatggatgacttt
gaggaccttctgaaccaccgcctcatgagtgagggtggaaatgtcgcctcaatgttggcc
caagctccatgccaacaagctgcccctcccacctcctctactgctgcccaaagcaacaca
gtatcccagaacacttctgaccctgccagcaacccaggaagcacctggatgaattacccc
aacagcatcgtcagcttgctccagaacgagagcatgattgacattgcatccaacaacagc
caccgggcccctgtgctggatgagtttgacgagctgatgtctgctgacgaggatcgtctt
atttccattttcaacagtgaaagccaagctgggtttgtgtcaggacacccaacctaa

DBGET integrated database retrieval system