KEGG   Lates calcarifer (barramundi perch): 108882519Help
Entry
108882519         CDS       T04895                                 

Gene name
gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
lcf04115  p53 signaling pathway
lcf04210  Apoptosis
lcf04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108882519 (gadd45g)
   04068 FoxO signaling pathway
    108882519 (gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108882519 (gadd45g)
   04210 Apoptosis
    108882519 (gadd45g)
   04115 p53 signaling pathway
    108882519 (gadd45g)
   04218 Cellular senescence
    108882519 (gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108882519 (gadd45g)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108882519 (gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108882519 (gadd45g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 108882519
NCBI-ProteinID: XP_018530573
LinkDB All DBs
Position
Unknown
AA seq 159 aa AA seqDB search
MTLEEIHGQENTMENADRVQSAGAALEELLVAAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGANETGEPKDAHCIL
VTSPSANPWKDPALDKLSLFCEESRSVYDWVPTITLPER
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagagatccacggacaagagaacacgatggaaaacgcagatagggtgcaa
agtgcaggcgcagccctggaggagctgctggtcgctgccaagaagcaggactacctgaca
gttggagtttacgaatctgctaaagtcatgaatgttgacccagacagcgtggcgttctgc
gtcctcgccaccgacgaggagtacgagtgtgacatcgccctccagatccactttaccctc
atccaggctttctgcttcgacaacgacatcaacgtggtgcgcgtcaacgacatcgagcgc
ctggccgacctcgtgggtgcaaacgagaccggcgagcccaaggacgcgcactgcatactt
gtcacgagccccagtgcaaacccatggaaagaccctgctctggacaagctgagcctgttc
tgcgaggagagccgcagcgtgtacgactgggtgcccaccatcacactcccagagcgctga

DBGET integrated database retrieval system